The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKTFNLPLLVALFYLFVSVARSQGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIV
VPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPT
GGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKN
ITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGP
GHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTN
VLNPVIIDQEYCPYNHCKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVEL
ADIDLTFPGGAAVSQCKNVKPIVTGKQNPVACGAPATPAAP
Sequence Info Allergen Name Length Opt Bits Score E Value
ARS33724 Sal k 6.0101 401 2700 621.8 1.7e-179
AHL24657 Sal k 6.0101 379 2566 591.3 2.5e-170
ABY21306 Pla or 2.0101 378 1244 289.9 1.3e-79
Q6H9K0 Pla a 2 377 1237 288.3 3.9e-79
A0A077B155 Sor h 13.0101 422 1109 259.1 2.7e-70
A0A077B569 Sor h 13.0201 410 1101 257.3 9.2e-70
CAB42886 Phl p 13 394 1043 244.1 8.4e-66
W8PPL3 Ole e 14.0101 379 1028 240.7 8.6e-65
P43212 Cry j 2 514 797 188.0 8.7e-49
BAA06172 Cry j 2 514 797 188.0 8.7e-49
Q7M1E7 Cha o 2.0101 514 793 187.1 1.6e-48
CAC05582 Jun a 2 507 740 175.0 7e-45
C9EA45 Cari p 1.0101 494 711 168.4 6.6e-43
C0HKB1 Cup s 2.0101 164 145 39.9 0.00011
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal k 6.0101 Sequence ID: ARS33724

 Score = 621.8 bits 2700,  Expect = 2e-179
 Identities = 401/401 100%, Positives = 401/401 100%, Gaps = 0/401 0%
Query  1    MKTFNLPLLVALFYLFVSVARSQGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIV 60
            MKTFNLPLLVALFYLFVSVARSQGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIV
Sbjct  1    MKTFNLPLLVALFYLFVSVARSQGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIV 60
Query  61   VPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPT 120
            VPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPT
Sbjct  61   VPAGEFLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPT 120
Query  121  GGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKN 180
            GGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKN
Sbjct  121  GGTFDGQGQAAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKN 180
Query  181  ITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGP 240
            ITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGP
Sbjct  181  ITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGP 240
Query  241  GHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTN 300
            GHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTN
Sbjct  241  GHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTN 300
Query  301  VLNPVIIDQEYCPYNHCKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVEL 360
            VLNPVIIDQEYCPYNHCKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVEL
Sbjct  301  VLNPVIIDQEYCPYNHCKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVEL 360
Query  361  ADIDLTFPGGAAVSQCKNVKPIVTGKQNPVACGAPATPAAP 401
            ADIDLTFPGGAAVSQCKNVKPIVTGKQNPVACGAPATPAAP
Sbjct  361  ADIDLTFPGGAAVSQCKNVKPIVTGKQNPVACGAPATPAAP 401

Sequence Alignment: 2. Allergen Name: Sal k 6.0101 Sequence ID: AHL24657

 Score = 591.3 bits 2566,  Expect = 3e-170
 Identities = 379/379 100%, Positives = 379/379 100%, Gaps = 0/379 0%
Query  23   QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT 82
            QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT
Sbjct  1    QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT 60
Query  83   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 142
            IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM
Sbjct  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
Query  143  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 202
            CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI
Sbjct  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
Query  203  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 262
            GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF
Sbjct  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
Query  263  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 322
            VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP
Sbjct  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
Query  323  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI 382
            SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI
Sbjct  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI 360
Query  383  VTGKQNPVACGAPATPAAP 401
            VTGKQNPVACGAPATPAAP
Sbjct  361  VTGKQNPVACGAPATPAAP 379

Sequence Alignment: 3. Allergen Name: Pla or 2.0101 Sequence ID: ABY21306

 Score = 289.9 bits 1244,  Expect = 1e-79
 Identities = 174/370 47%, Positives = 245/370 66%, Gaps = 8/370 2%
Query  19   VARSQGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCK 78
            V  S G  ++  +GAK + D + A++ AW+ ACA+  P+ +++P G +++  V L+GPCK
Sbjct  4    VQSSGGTFNVNDYGAKGSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCK 63
Query  79   -APLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKC 137
             + +  ++ G  KAPADV+  K E  WV   +V GLT++     GTFDGQGQ AW  N C
Sbjct  64   GSKIGFQLDGVVKAPADVSAFKSEG-WVVFNHVDGLTVS---GKGTFDGQGQKAWAANNC 119
Query  138  AQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNT 197
             +   CN  P N RFN L NA +  I S+NSK++H+ V+ C NI++  +TI AP  S+NT
Sbjct  120  DKDENCNRPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINT 179
Query  198  DGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAP 257
            DG+HIG S GV  T++ I TGDDC+S+G G+ +V V  + CGPGHGIS+GS+GK+ +E  
Sbjct  180  DGIHIGLSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKD 239
Query  258  NTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHC 317
              GI V  C+FT T NGVR+K+W +S    A+D+ FED+T+ NV NPVI+DQEYCPY +C
Sbjct  240  VRGITVTGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQC 299
Query  318  KEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTF--PGGAAVSQ 375
              K PS+VKLS I F N+ G +   + + + CS   PC  +E+ +I+L +   G  A S 
Sbjct  300  SLKAPSRVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANST 359
Query  376  CKNVKPIVTGKQNP-VAC 392
            C N KPI +GKQ P + C
Sbjct  360  CTNAKPIFSGKQVPAIKC 377

Sequence Alignment: 4. Allergen Name: Pla a 2 Sequence ID: Q6H9K0

 Score = 288.3 bits 1237,  Expect = 4e-79
 Identities = 170/368 46%, Positives = 251/368 68%, Gaps = 9/368 2%
Query  21   RSQGPI-DITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCK- 78
            +S G + ++  +GAK   D + A++ AWK ACA+  P+ +++P G + +  V +QGPCK 
Sbjct  4    QSSGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKG 63
Query  79   APLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCA 138
            + +  +I G  KAPAD ++ K  D WV    + GLT++     GT+DGQGQ AW +N C 
Sbjct  64   SKIGFQIDGVVKAPADPSKFKS-DGWVSFYRIDGLTVSGT---GTLDGQGQTAWAKNNCD 119
Query  139  QSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
            ++  C     N+RF+ L +A +  I SLNSK++H+ V+ C++IT+  +T+ AP  S+NTD
Sbjct  120  KNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTD 179
Query  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
            G+H+G S GV  TN+KI TGDDCIS+G G+ +V +  + CGPGHGISIGS+G++ NE   
Sbjct  180  GIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEV 239
Query  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
             GI VK C+F+ T NGVR+K+W NS   +A+DL F+D+T+ NV NPVI+DQEYCPY +C 
Sbjct  240  RGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCS 299
Query  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTF--PGGAAVSQC 376
             + PS++KLS I+F N+ G +     V + CS  +PC  +++ +I+L++   GG A S C
Sbjct  300  RQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTC 359
Query  377  KNVKPIVTGKQNP-VAC 392
             NVKP  +GKQ P + C
Sbjct  360  SNVKPTFSGKQVPAIKC 376

Sequence Alignment: 5. Allergen Name: Sor h 13.0101 Sequence ID: A0A077B155

 Score = 259.1 bits 1109,  Expect = 3e-70
 Identities = 160/366 43%, Positives = 238/366 65%, Gaps = 10/366 2%
Query  22   SQGPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKA 79
            S G  DI+K+GAK +   D+T AL  AW  AC    P  +++P G++L   + + GPCK 
Sbjct  51   SAGGSDISKLGAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGDYLTGPLNFSGPCKG 110
Query  80   PLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ 139
             +TI++ GN+    D++  K    W++IE+V  L I+     GT+DGQG+  W  NKCAQ
Sbjct  111  SVTIQLDGNLLGTTDLSAYK--TNWIEIEHVDNLVIS---GKGTLDGQGKQVWDNNKCAQ 165
Query  140  SGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDG 199
               C  LP ++ ++ + N ++SGI  LN+K++HM V  CK +T+  +T+ AP DS NTDG
Sbjct  166  KYDCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDG 225
Query  200  MHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNT 259
            +HIG S+ V  T + IG GDDCIS+G G+  ++V G+TCGPGHGIS+GS+G++ +E   T
Sbjct  226  IHIGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVT 285
Query  260  GIFVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
             I VK+C++  T NGVRIKS+ ++    +AS LH+E+I + +V NP+IID +YCP   C 
Sbjct  286  DINVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICT 345
Query  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQC 376
             K  SKV +  ++FKN+ G + + E V LLCS  +PC GV + +I + + G     ++ C
Sbjct  346  AKGDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVC 405
Query  377  KNVKPIVTGKQNPVAC 392
            +N K   TG    +AC
Sbjct  406  QNAKGSATGCLKELAC 421

Sequence Alignment: 6. Allergen Name: Sor h 13.0201 Sequence ID: A0A077B569

 Score = 257.3 bits 1101,  Expect = 9e-70
 Identities = 158/364 43%, Positives = 236/364 64%, Gaps = 10/364 2%
Query  24   GPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPL 81
            G  DI+K+GA  +   D+T A+  AW  AC       I++P G++L+  + + GPCK  +
Sbjct  41   GSFDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKGDYLVGPLNFTGPCKGDV 100
Query  82   TIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSG 141
            TI++ GN+ A  D++Q KG   W++I  V  L IT     G +DGQG A W +N CA+  
Sbjct  101  TIQVDGNLLATTDLSQYKGN--WIEILRVDNLVIT---GKGKLDGQGPAVWSKNSCAKKY 155
Query  142  MCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMH 201
             C  LP ++ ++ + N ++SGI  LN+K++HM V  CK +T+  +T+ AP DS NTDG+H
Sbjct  156  DCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIH 215
Query  202  IGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGI 261
            IG S+ V  T + IG GDDCIS+G G+  ++V G+TCGPGHGIS+GS+G++ +E   T I
Sbjct  216  IGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDI 275
Query  262  FVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEK 320
             VK+C++  T NGVRIKS+ ++    +AS LH+E+I + +V NP+IID +YCP   C  K
Sbjct  276  NVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTAK 335
Query  321  TPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQCKN 378
              SKV +  ++FKN+ G + + E V LLCS  +PC GV + +I + + G     ++ C+N
Sbjct  336  GDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQN 395
Query  379  VKPIVTGKQNPVAC 392
             K   TG    +AC
Sbjct  396  AKGSATGCLKELAC 409

Sequence Alignment: 7. Allergen Name: Phl p 13 Sequence ID: CAB42886

 Score = 244.1 bits 1043,  Expect = 8e-66
 Identities = 155/368 42%, Positives = 234/368 63%, Gaps = 12/368 3%
Query  22   SQGPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKA 79
            + G  DITK+GAKP+   D T  +  AW  AC       IV+P G+FL   + + GPCK 
Sbjct  20   ADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKG 79
Query  80   P-LTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCA 138
              +TI++ GN+ +  D+A+ K    W++I  ++ LTIT     GT+DGQG+A W +N CA
Sbjct  80   DSVTIKLDGNLLSSNDLAKYKA--NWIEIMRIKKLTIT---GKGTLDGQGKAVWGKNSCA 134
Query  139  QSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
            ++  C  LP  + ++   +A I GI  LN+K++HM +  CK +T+  +TI AP DS NTD
Sbjct  135  KNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTD 194
Query  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
            G+HIG S+ V  T++ IGTGDDCIS+G G+  +++ G+TCGPGHGIS+GS+G++ +E   
Sbjct  195  GIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDV 254
Query  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHC 317
            T I VKNC +  + NG+RIKS+ ++    +AS L +E++ + +V  P+IIDQ+YCP   C
Sbjct  255  TDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKIC 314
Query  318  KEKTPS-KVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVS 374
              K  S +V +  ++F+N+ G + + E V LLCS   PC+GV + D+ + + G     ++
Sbjct  315  TSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMA 374
Query  375  QCKNVKPIVTGKQNPVACGA 394
             C N K    G      C A
Sbjct  375  VCTNAKVTAKGVSEANTCAA 394

Sequence Alignment: 8. Allergen Name: Ole e 14.0101 Sequence ID: W8PPL3

 Score = 240.7 bits 1028,  Expect = 9e-65
 Identities = 166/356 46%, Positives = 228/356 64%, Gaps = 17/356 4%
Query  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAP--LT 82
            D+ K+GAK +   D   A++ AWK AC +  PAK+V+P G+F+   V +QGPC AP  +T
Sbjct  17   DVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPIT 76
Query  83   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 142
            IEI GN  A  DV+      +W+ +E + GL I     GGT +G+G+++W+       G 
Sbjct  77   IEIQGNVLASTDVSAYTS-GSWIMLEEIDGLVIN---GGGTINGRGKSSWQFAGANNEGP 132
Query  143  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 202
               LP ++ F  + N+++  +  ++S  +H  V   +NI ++ L I AP DS NTDGMHI
Sbjct  133  L--LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHI 190
Query  203  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 262
              S  V+ T+S IGTGDDC+S+G G  D+ V GITCGPGHGIS+GS+GK  +E    GI 
Sbjct  191  SCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGIS 250
Query  263  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 322
            V NC++T T NG RIK++  S    ASD+ ++DI VT+V NP++IDQ Y   +  K+   
Sbjct  251  VINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKKKPEQ 307
Query  323  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQ---CKNV 379
            SKVK+S + F N+ G   S   V L CS AVPC+ VELADIDL  P GAA S    C N 
Sbjct  308  SKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSVCANA 366
Query  380  KPIVTGKQNPVAC 392
            K ++ GK  P  C
Sbjct  367  KFVLKGKPIPPGC 379

Sequence Alignment: 9. Allergen Name: Cry j 2 Sequence ID: P43212

 Score = 188.0 bits 797,  Expect = 9e-49
 Identities = 127/365 34%, Positives = 213/365 58%, Gaps = 19/365 5%
Query  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 83
            ++ K+GA  +   D T A+  AW+ AC   + A ++VP  + F++N + + GPC+  +T 
Sbjct  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKKPS-AMLLVPGNKKFVVNNLFFNGPCQPHFTF 118
Query  84   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 141
            ++ G   A  + A  K    W++   + G+T   L   G  DGQG+  W   +C   +G 
Sbjct  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFT---LMGKGVIDGQGKQWWA-GQCKWVNGR 174
Query  142  -MCNSL--PYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
             +CN    P   +F+  T   I G+K +NS  +H+    C+ + + G++I AP+DS NTD
Sbjct  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
Query  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
            G+ I  S   H   + IGTGDDC+++G G+ ++ +E + CGPGHGISIGS+G+  + A  
Sbjct  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
Query  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  295  SYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASAC 353
Query  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 376
            +   S V++  +++KN+ G + +A  ++L CS ++PC  ++L+DI L +  G  ++ C  
Sbjct  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGK-IASCLN 412
Query  377  KNVKPIVTGKQNPVACGAPATPAA 400
             N     +G   P AC    +P+A
Sbjct  413  DNANGYFSGHVIP-ACKN-LSPSA 434

Sequence Alignment: 10. Allergen Name: Cry j 2 Sequence ID: BAA06172

 Score = 188.0 bits 797,  Expect = 9e-49
 Identities = 127/365 34%, Positives = 213/365 58%, Gaps = 19/365 5%
Query  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 83
            ++ K+GA  +   D T A+  AW+ AC   + A ++VP  + F++N + + GPC+  +T 
Sbjct  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKNPS-AMLLVPGSKKFVVNNLFFNGPCQPHFTF 118
Query  84   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 141
            ++ G   A  + A  K    W++   + G+T   L   G  DGQG+  W   +C   +G 
Sbjct  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFT---LMGKGVIDGQGKQWWA-GQCKWVNGR 174
Query  142  -MCNSL--PYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
             +CN    P   +F+  T   I G+K +NS  +H+    C+ + + G++I AP+DS NTD
Sbjct  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
Query  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
            G+ I  S   H   + IGTGDDC+++G G+ ++ +E + CGPGHGISIGS+G+  + A  
Sbjct  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
Query  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  295  SYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASAC 353
Query  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 376
            +   S V++  +++KN+ G + +A  ++L CS ++PC  ++L+DI L +  G  ++ C  
Sbjct  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGK-IASCLN 412
Query  377  KNVKPIVTGKQNPVACGAPATPAA 400
             N     +G   P AC    +P+A
Sbjct  413  DNANGYFSGHVIP-ACKN-LSPSA 434

Sequence Alignment: 11. Allergen Name: Cha o 2.0101 Sequence ID: Q7M1E7

 Score = 187.1 bits 793,  Expect = 2e-48
 Identities = 126/358 35%, Positives = 210/358 58%, Gaps = 18/358 5%
Query  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 83
            ++ ++GA  +   D+T A+   W  AC  A+ A ++VPA + F++N + ++GPC+  L+ 
Sbjct  60   NVEQYGAVGDGKHDSTEAFATTWNAACKKAS-AVLLVPANKKFFVNNLVFRGPCQPHLSF 118
Query  84   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSG-- 141
            ++ G   A  D A+ K    W++      LT   L   G  DGQGQ  W       +G  
Sbjct  119  KVDGTIVAQPDPARWKNSKIWLQFAQ---LTDFNLMGTGVIDGQGQQWWAGQCKVVNGRT 175
Query  142  MCN--SLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMG-CKNITLTGLTIDAPKDSLNTD 198
            +CN  + P   + +   +  +  +  +NS  +H+ V G C+ + + GL I AP+DS NTD
Sbjct  176  VCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHL-VFGECEGVKIQGLKIKAPRDSPNTD 234
Query  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
            G+ I  S   H     IGTGDDCI++G G+ ++ ++ + CGPGHGISIGS+G+  + A  
Sbjct  235  GIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEV 294
Query  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  295  SHVHVNRAKFIDTQNGLRIKTWQGG-SGLASYITYENVEMINSENPILINQFYCTSASAC 353
Query  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 376
            +   S V++  +++KN+HG + +A  ++L+CS +VPC G++L+++ L +  G   S C  
Sbjct  354  QNQRSAVQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKLTSGKPAS-CVD 412
Query  377  KNVKPIVTGKQNPVAC 392
            KN +   +G+  P  C
Sbjct  413  KNARGFYSGRLIPT-C 427

Sequence Alignment: 12. Allergen Name: Jun a 2 Sequence ID: CAC05582

 Score = 175.0 bits 740,  Expect = 7e-45
 Identities = 123/356 34%, Positives = 204/356 57%, Gaps = 22/356 6%
Query  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 83
            ++  +GA  +   D+T A+   W  AC   + A  +VPA + F++N + + GPC+  ++ 
Sbjct  61   NVEHYGAVGDGKHDSTDAFEKTWNAACNKLS-AVFLVPANKKFVVNNLVFYGPCQPHFSF 119
Query  84   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 141
            ++ G   A  D A+ K    W+       LT   L   G  DGQG   W  ++C   +G 
Sbjct  120  KVDGTIAAYPDPAKWKNSKIWMHFAR---LTDFNLMGTGVIDGQGNR-WWSDQCKTINGR 175
Query  142  -MCNSL--PYNFRFNTLTNAQISGIKSLNSKLYHMGVMG-CKNITLTGLTIDAPKDSLNT 197
             +CN    P   + +   +  +  +   NS  +H+ V G C  + + G+ I AP+DS NT
Sbjct  176  TVCNDKGRPTAIKIDFSKSVTVKELTLTNSPEFHL-VFGECDGVKIQGIKIKAPRDSPNT 234
Query  198  DGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAP 257
            DG+ I  S         IGTGDDC+++G G+ ++ ++ +TCGPGHG+SIGS+GK  + + 
Sbjct  235  DGIDIFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSE 294
Query  258  NTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNH- 316
             + + +    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC     
Sbjct  295  VSFVHLDGAKFIDTQNGLRIKTWQGG-SGLASHITYENVEMINAENPILINQFYCTSAAA 353
Query  317  CKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC 376
            CK +  S VK+  ++FKN+HG + +   ++L+CS +VPC  ++L+++ L +  G  V+ C
Sbjct  354  CKNQR-SAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLTSGK-VATC 411
Query  377  --KNVKPIVTGKQNPVAC 392
              KN     T   NP +C
Sbjct  412  VNKNANGYYTNPLNP-SC 428

Sequence Alignment: 13. Allergen Name: Cari p 1.0101 Sequence ID: C9EA45

 Score = 168.4 bits 711,  Expect = 7e-43
 Identities = 116/336 34%, Positives = 197/336 58%, Gaps = 21/336 6%
Query  21   RSQGP----IDITKFGAKPNA---DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVK 72
            RS  P     ++  FGA+ +    D    +  AW++AC+   PA  +VP    +L+  ++
Sbjct  108  RSAKPRSVIFNVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGPALFLVPERRTYLIGPIR 167
Query  73   LQGPCKAPLTIE--IAGNFKAPADVAQMKGEDT-WVKIENVQGLTITCLPTGGTFDGQGQ 129
            + GPCK+ L I+  I+G   A  + +  + +   W+ I++V  L +     GGT  G GQ
Sbjct  168  FLGPCKSNLVIQVQISGTILASDNRSDYRKDPRHWIVIDSVDNLLVE---GGGTIHGNGQ 224
Query  130  AAWKQNKCAQSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTID 189
              W+ N C     C   P    F    N  +  +K  +++  ++    C  +T + LT+ 
Sbjct  225  IWWR-NSCKAP--CKEAP-TVTFYKCKNLMVRNVKVQDAQQMQVSFEKCSEVTASDLTVT 280
Query  190  APKDSLNTDGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSM 249
            AP+ S NTDG+H+  +  +  TN+ IG GDDCIS+  G+ +V++E +TCGPGHGI++ S+
Sbjct  281  APEKSPNTDGIHVTNTQNILITNTFIG-GDDCISIESGSHNVQIEELTCGPGHGINVDSL 339
Query  250  GKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQ 309
            G   ++A  + + V    ++ T NGVRIK++      SAS++ F+++ + NV NP+IIDQ
Sbjct  340  GDNNSKAFVSFVTVNGAKLSGTTNGVRIKTYQGG-SGSASNIKFQNVDMENVKNPIIIDQ 398
Query  310  EYCPYNH-CKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDL 365
             YC     CK++  S V++  + ++N++G + S   + + CS   PC GV+L ++ L
Sbjct  399  NYCDQKKPCKKQQKSAVQVKDVLYQNIQGNSASDVAIDFDCSENYPCLGVKLQNVRL 455

Sequence Alignment: 14. Allergen Name: Cup s 2.0101 Sequence ID: C0HKB1

 Score = 39.9 bits 145,  Expect = 0.0001
 Identities = 26/62 41%, Positives = 38/62 61%, Gaps = 9/62 14%
Query  236  ITCGPGHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFED 295
            +TCGPGHG+SIGS+GK  + +  + + +    F DT NG+R             D+ F++
Sbjct  98   LTCGPGHGMSIGSLGKGNSRSEVSFVHLDGAKFIDTQNGLRSA-------VKIEDVTFKN 150
Query  296  IT--VTNVLNP 304
                 TN LNP
Sbjct  151  ANGYYTNPLNP 161

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.