The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY
EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV
RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA
PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA
KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP
TPTTTPTTPTTTPTTPSPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTS
TPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCP
PGTIWCQEKLTCIGE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD52672 Der f 15.0101 555 3919 899.5 0
Q4JK70 Der p 15.0102 558 3571 820.2 0
Q4JK69 Der p 15.0101 532 3004 691.0 4.8e-200
AKH04311 Per a 12.0101 407 869 204.4 1.1e-53
AII81930 Bla g 12.0101 539 804 189.5 4.4e-49
Q4JK71 Der p 18.0101 462 331 81.7 1.1e-16
AAM19082 Der f 18.0101 462 329 81.2 1.5e-16
ALU66112 Der f 23.0101 174 157 42.5 2.5e-05
Q17282 Blo t 12 144 148 40.7 7.4e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 899.5 bits 3919,  Expect = 0
 Identities = 555/555 100%, Positives = 555/555 100%, Gaps = 0/555 0%
Query  1    MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
            MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
Sbjct  1    MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
Query  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY 120
            CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY
Sbjct  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY 120
Query  121  EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV 180
            EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV
Sbjct  121  EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV 180
Query  181  RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA 240
            RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA
Sbjct  181  RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA 240
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
            PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
Query  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
            KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
Sbjct  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  361  KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP 420
            KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP
Sbjct  361  KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP 420
Query  421  TPTTTPTTPTTTPTTPSPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTS 480
            TPTTTPTTPTTTPTTPSPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTS
Sbjct  421  TPTTTPTTPTTTPTTPSPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTS 480
Query  481  TPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCP 540
            TPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCP
Sbjct  481  TPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCP 540
Query  541  PGTIWCQEKLTCIGE 555
            PGTIWCQEKLTCIGE
Sbjct  541  PGTIWCQEKLTCIGE 555

Sequence Alignment: 2. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 820.2 bits 3571,  Expect = 0
 Identities = 505/552 91%, Positives = 534/552 96%, Gaps = 9/552 1%
Query  1    MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
            MKT  AIL +MAC GLMNA++KRDHN+YSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
Sbjct  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
Query  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY 120
            CTHLMYGFAKIDEYKYTIQVFDPYQDDNHN+WEK GYERFNNLRLKNPELTTMISLGGWY
Sbjct  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
Query  121  EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV 180
            EGSEKYSDM ANPTYRQQF+QSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL LV
Sbjct  121  EGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
Query  181  RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA 240
            RELK+AFEP GYLLTAAVSPGKDKID AY++KELN+LFDWMNVMTYDYHGGWEN +GHNA
Sbjct  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
            PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSK+KLGDPA
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
Query  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
            KGMSPPGFI+GEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
Sbjct  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  361  KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP 420
            KLAFLKELGVSGVM+WSLENDDFKGHCGPK PLLNKVHNMINGDEKNS+EC+LGPSTTTP
Sbjct  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
Query  421  TPTTTPTTP-TTTPTTPSPTTP-TTTPSPTTP----TTTPSPTTPTTTPSPTTPTPTTPT 474
            TPTT P+TP TTTPT  +P+TP TTTP+PTTP    TTTP+PTTP+T PS TTPTPTTP+
Sbjct  421  TPTT-PSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPST-PSTTTPTPTTPS 478
Query  475  PAPTTSTPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWV 534
               +T+TP+PTTT+ TSETPKYTTYVDGHLIKCYKEGD+PHPTNIHKYLVCE+VNGGWWV
Sbjct  479  TT-STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWV 537
Query  535  HIMPCPPGTIWCQEKLTCIGE 555
            HIMPCPPGTIWCQEKLTCI E
Sbjct  538  HIMPCPPGTIWCQEKLTCITE 558

Sequence Alignment: 3. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 691.0 bits 3004,  Expect = 5e-200
 Identities = 490/532 92%, Positives = 517/532 97%, Gaps = 23/532 4%
Query  1    MKTIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
            MKT  AIL +MAC GLMNA++KRDHN+YSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK
Sbjct  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHKVDPYTIEDIDPFK 60
Query  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWY 120
            CTHLMYGFAKIDEYKYTIQVFDPYQDDNHN+WEK GYERFNNLRLKNPELTTMISLGGWY
Sbjct  61   CTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGWY 120
Query  121  EGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALV 180
            EGSEKYSDM ANPTYR+QF+QSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL LV
Sbjct  121  EGSEKYSDMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLTLV 180
Query  181  RELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYGHNA 240
            RELK+AFEP GYLLTAAVSPGKDKID AY++KELN+LFDWMNVMTYDYHGGWEN +GHNA
Sbjct  181  RELKEAFEPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVFGHNA 240
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
            PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSK+KLGDPA
Sbjct  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVKLGDPA 300
Query  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
            KGMSPPGFI+GEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC
Sbjct  301  KGMSPPGFITGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
Query  361  KLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTP 420
            KLAFLKELGVSGVM+WSLENDDFKGHCGPK PLLNKVHNMINGDEKNS+EC+LGPSTTTP
Sbjct  361  KLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSYECLLGPSTTTP 420
Query  421  TPTTTPTTPTTTPTTPSPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTS 480
            TPTT        P+TPS    TTTP+PTTP+T          PS TTPTPTTP+  P+T+
Sbjct  421  TPTT--------PSTPS----TTTPTPTTPST----------PSTTTPTPTTPS-TPSTT 457
Query  481  TPSPTTTEHTSETPKYTTYVDGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCP 540
            TP+PTTT+ TSETPKYTTYVDGHLIKCYKEGD+PHPTNIHKYLVCE+VNGGWWVHIMPCP
Sbjct  458  TPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIMPCP 517
Query  541  PGTIWCQEKLTCIGE 555
            PGTIWCQEKLTCI E
Sbjct  518  PGTIWCQEKLTCITE 532

Sequence Alignment: 4. Allergen Name: Per a 12.0101 Sequence ID: AKH04311

 Score = 204.4 bits 869,  Expect = 1e-53
 Identities = 143/388 36%, Positives = 219/388 56%, Gaps = 14/388 3%
Query  4    IYAILSIMACIGLMNASIKRDHNDYSKNPMRIV-CYVGTWSVYH-KVDPYTIEDIDPFKC 61
            ++   ++  C G++    K       K   R V CY G+W+ Y   +  + +++ID   C
Sbjct  13   VFLAAALQTCKGFIR-DFKTHRQLQEKGDDRAVFCYYGSWATYRWGIATFEVDNIDTRLC 71
Query  62   THLMYGFAKIDEYKYTIQVFDPYQDDNHNSWEKRGYERFNNLRLKNPELTTMISLGGWYE 121
            TH++Y F  + +    I  +D Y D   N W K   ++F  L  KN  +  ++ LGGW E
Sbjct  72   THIVYAFTGLRD--GVIVSLDEYNDYEEN-WGKGLMKKFTTLA-KNNGIKALVGLGGWNE 127
Query  122  GSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYLALVR 181
            GS KYS+MAA    R+ F  S + FLQ+  FDGLDLDWEYP  R G P+ DK N+  L++
Sbjct  128  GSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPE-DKDNFTLLLK 186
Query  182  ELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHG-GWENFYGHNA 240
             L + +   G +LT AVS        AYD   + K  D++ +M++DYH    +   G N+
Sbjct  187  TLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNS 246
Query  241  PLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLGDPA 300
            PL   P +T   +  +NV Y+++ +L  G   +KLV+GVP+YGR + + D  +  LG P 
Sbjct  247  PLDSLPQDTG-YNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHGLGAPI 305
Query  301  KGMSPPGFISGEEGVLSYIELCQLFQKEEWHIQYDEYYNAPYGYNDKIWVGYDDLASISC 360
             G    G+ + E G L+Y E+C      +W++ +++  +  Y Y D  W+ YDD  +I+ 
Sbjct  306  LGPGTAGLYTQEAGFLAYYEICS---NPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTITI 362
Query  361  KLAFLKELGVSGVMVWSLENDDFKGHCGPKN-PLLNKVHNMI 401
            K  ++ E  + GVMVWSLE+DDF G+CG    PLL  V+  +
Sbjct  363  KAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKAL 404

Sequence Alignment: 5. Allergen Name: Bla g 12.0101 Sequence ID: AII81930

 Score = 189.5 bits 804,  Expect = 4e-49
 Identities = 189/489 38%, Positives = 284/489 58%, Gaps = 43/489 8%
Query  32   PMRIVCYVGTWSVYHK-VDPYTIEDIDPFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNHN 90
            P R+VCY   W+VY   +  Y IEDI    CTHL+Y F  +         + P   D  N
Sbjct  26   PSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIGVSNV-----TWGPLILDQEN 80
Query  91   SWEKRGYERFNNLRLKNPELTTMISLGGWYEGSEKYSDMAANPTYRQQFIQSVLDFLQEY 150
              + RG+  F +L+ K   + T +++GGW EG  KYS + ++   R  FI ++++FL++Y
Sbjct  81   DVDLRGFLNFTDLKAKG--VKTSVAMGGWGEGGRKYSHLVSDKKLRDTFIPALVEFLHKY 138
Query  151  KFDGLDLDWEYPG-SRLGNPKIDKQNYLALVRELKDAF--EPHGYLLTAAVSPGKDKIDR 207
             FDGLD+DWEYPG S  G    D+QN++ +V EL+ AF  E  G+ +T AV     +++ 
Sbjct  139  NFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWEITMAVPLANFRLNE 198
Query  208  AYDIKELNKLFDWMNVMTYDYHGGWENFYGHNAPLYKRPDETDELHTYFNVNYTMHYYLN 267
             Y + +L +L D ++VM YD  G W  F   ++PLY+RP+E    +  +N N  M+ +++
Sbjct  199  GYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNE-GYGYQALNDNDGMQLWVD 257
Query  268  NGATRDKLVMGVPFYGRAWSIEDRSKLK-LG---DPAKGMSPPGFISGEEGVLSYIELCQ 323
             G + DKLV+G PFYGR +++   +  K +G   +   G    G  +G +G+L+Y E+C 
Sbjct  258  KGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYTGAKGMLAYYEICN 317
Query  324  LFQ--KEEWHIQYDEYYNAPYGYND-KIWVGYDDLASISCKLAFLKELGVSGVMVWSLEN 380
            ++Q    +W  ++D+    PY Y+D   WVGYD+  S+  K+ F+KE G  G M W+++ 
Sbjct  318  MLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMDFIKEKGYLGAMTWAIDM 377
Query  381  DDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTPTPTTTPTTPTTTPTTPSPTT 440
            DDF G CG KNPL+N +        KN  + ++     + TP      P +T       T
Sbjct  378  DDFHGTCGQKNPLINVL-------AKNMKDYVVPTLQISTTPRPEWDRPKSTTFEGGSVT 430
Query  441  PTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTSTPSPTTTEHTSETPKYTTYV 500
             +TT + T  TT P  TT  TT S   PT TTP+  P    PS TTT+ T+  P  T   
Sbjct  431  TSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPS-FP----PSETTTDATTGGPTVTP-- 483
Query  501  DGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCPPGTIWCQEKLTC 552
                  C      P   N ++Y +C   N G  + +M CP GT+W QE + C
Sbjct  484  -----SCANANFYP-AANCNQYYMC---NQGTPI-LMTCPSGTVWVQEGIRC 525

Sequence Alignment: 6. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 81.7 bits 331,  Expect = 1e-16
 Identities = 128/362 35%, Positives = 195/362 53%, Gaps = 54/362 14%
Query  34   RIVCYVGTWSVYH----KVDPYTIEDIDPFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNH 89
            + VCY  +W  +     K+DP   EDID   C+H++Y +  ID   + I+++D Y     
Sbjct  30   KTVCYYESWVHWRQGDGKMDP---EDIDTSLCSHIVYSYFGIDASSHEIKLLDQYLMITL 86
Query  90   NSWEKRGYERFNNLRLKNPELTTMISLGGWYEGSEKYSDMAANPTYRQQFIQSVLDFLQE 149
            +  E     + N           MI++GG    S+++S  AA   YR+ F+ S +D++ +
Sbjct  87   HDMEHFTKHKGNA--------KAMIAVGG-ASMSDQFSKTAAVEHYRETFVVSTIDLMTK 137
Query  150  YKFDGLDLDWEYPGSRLGNPKIDKQNYLALVRELKDAFEPHGYLLTAAVSPGKDKIDRAY 209
            Y FDG+ +DW       G    D  N++ L+ ++ + F    +++   +       D  Y
Sbjct  138  YGFDGVMIDWS------GMQAKDSDNFVKLLDKFDEKFAQTSFVMGVTLPATIASYDN-Y 190
Query  210  DIKELNKLFDWMNVMTYDYHGGWENFYGHNAPLYKRPDETDELHTYFNVNYTMHYYLNNG 269
            +I  ++   D+MNV+T DY G W    GH + L   P++            T+  Y   G
Sbjct  191  NIPAISNYVDFMNVLTLDYDGPWAYTVGHASAL---PEQLK----------TLEAYNKRG 237
Query  270  ATRDKLVMGVPFYGRAWSIEDRSKLKLGDPAKGMSPPGFISGEEGVLSYIELCQLFQKEE 329
            A R K+VM VPF+ R W +E   K  +GD A G  P G  +   G LSY ELC   Q E 
Sbjct  238  APRHKMVMAVPFFARTWILEKMDKQDVGDKASGPGPKGQFTQTPGFLSYNELCVQIQAET 297
Query  330  --WHIQYDEYYNAPYGY----NDKIWVGYDDLASISCKLAFLKELGVSGVMVWSLENDDF 383
              + I  D    A Y      N   W+ ++D  ++  K   + E G  G+ V++L N+D 
Sbjct  298  NAFSITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARNITEQGYGGMSVYTLSNEDV 357
Query  384  KGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTPTPTT-TPTTPTTTPTTPSP 438
             G CG KNPLL+ +++       N F  I+    T PT  T TP T TT   T  P
Sbjct  358  HGVCGDKNPLLHAINS-------NYFRGIV----TEPTVVTVTPVTHTTEHVTDIP 402

Sequence Alignment: 7. Allergen Name: Der f 18.0101 Sequence ID: AAM19082

 Score = 81.2 bits 329,  Expect = 1e-16
 Identities = 135/385 35%, Positives = 214/385 55%, Gaps = 62/385 16%
Query  3    TIYAILSIMACIGLMNASIKRDHNDYSKNPMRIVCYVGTWSVYH----KVDPYTIEDIDP 58
            T+ A+L+  AC G   ++I+   N  +  P + VCY  +W  +     K+DP   EDID 
Sbjct  7    TVLAVLA--ACFG---SNIR--PNVATLEP-KTVCYYESWVHWRQGEGKMDP---EDIDT 55
Query  59   FKCTHLMYGFAKIDEYKYTIQVFDPY-QDDNHNSWEKRGYERFNNLRLKNPELTTMISLG 117
              CTH++Y +  ID   + I+++D Y   D H+       E F   +        MI++G
Sbjct  56   SLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHD------MEHFTQHK---GNAKAMIAVG 106
Query  118  GWYEGSEKYSDMAANPTYRQQFIQSVLDFLQEYKFDGLDLDWEYPGSRLGNPKIDKQNYL 177
            G    S+++S  AA   YR+ F+ S +D++  Y FDG+ +DW       G    D  N++
Sbjct  107  G-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDWS------GMQAKDSDNFI 159
Query  178  ALVRELKDAFEPHGYLLTAAVSPGKDKIDRAYDIKELNKLFDWMNVMTYDYHGGWENFYG 237
             L+ ++ + F    +++   +       D  Y+I  ++   D+MNV++ DY G W +  G
Sbjct  160  KLLDKFDEKFAHTSFVMGVTLPATIASYDN-YNIPAISNYVDFMNVLSLDYTGSWAHTVG 218
Query  238  HNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKLKLG 297
            H +P+   P++   L  Y       H     GA R K+VM VPFY R W +E  +K  +G
Sbjct  219  HASPF---PEQLKTLEAY-------H---KRGAPRHKMVMAVPFYARTWILEKMNKQDIG 265
Query  298  DPAKGMSPPGFISGEEGVLSYIELCQLFQKEE--WHIQYDEYYNAPYGY----NDKIWVG 351
            D A G  P G  +  +G LSY ELC   Q E   + I  D    A Y      N   W+ 
Sbjct  266  DKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFTITRDHDNTAIYAVYVHSNHAEWIS 325
Query  352  YDDLASISCKLAFLKELGVSGVMVWSLENDDFKGHCGPKNPLLNKVHNMINGDEKNSFEC 411
            ++D  ++  K   + + G +G+ V++L N+D  G CG KNPLL+ +++       N +  
Sbjct  326  FEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVCGDKNPLLHAIQS-------NYYHG 378
Query  412  ILGPSTTTPTPTTTPTTPTTTPTTPSP 438
            ++   T    P   P T TT   T  P
Sbjct  379  VVTEPTVVTLP---PVTHTTEHVTDIP 402

Sequence Alignment: 8. Allergen Name: Der f 23.0101 Sequence ID: ALU66112

 Score = 42.5 bits 157,  Expect = 2e-05
 Identities = 50/122 40%, Positives = 68/122 55%, Gaps = 16/122 13%
Query  417  TTTPTPTTTPTTPTTTPTTPSPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPA 476
            TTT  P++ PTT + + +T  PTT T  PSPT  T  P+ TT   T +   P+PTT  P 
Sbjct  50   TTTVQPSSMPTT-SESESTVKPTTTTVKPSPT--TVKPTTTTVKLTTTTVKPSPTTVKPT 106
Query  477  PTTSTPSPTTTEHTS-ETPKYTTYVDGHLIKC-YKEGDIPHPTNIHKYLVCEFVNGGWWV 534
             TT  PSPTTT  T+ E P+          +C  + G    P +  K+ +C      W  
Sbjct  107  TTTVKPSPTTTTTTTTEQPEDE-------FECPTRFGYFADPKDPCKFYIC----SNWEA 155
Query  535  HIMPCPPGTIWCQEKLTC 552
                CP  T W +++LTC
Sbjct  156  IHKSCPGNTRWNEKELTC 173

Sequence Alignment: 9. Allergen Name: Blo t 12 Sequence ID: Q17282

 Score = 40.7 bits 148,  Expect = 7e-05
 Identities = 35/116 30%, Positives = 49/116 42%, Gaps = 7/116 6%
Query  437  SPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTSTPS---PTTTEHTSET 493
            S    TT    T P       T   T   TT T        TT TP     TTTE T  +
Sbjct  20   SADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHS 79
Query  494  PKYTTYVDG---HLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCPPGTIWCQEKL 550
                 +  G   H++ C++EG I      +KY++C      W++ +MPC  GT +     
Sbjct  80   DDLIVHEGGKTYHVV-CHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISR 138
Query  551  TCI 553
             C+
Sbjct  139  NCV 141

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.