The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKTSQILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLI
YSFIGVSNVTWGPLILDQENDVDLRGFLNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSD
KKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEG
KGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEG
YGYQALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDA
GPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMD
FIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVVPTLQISTTPRPEWDRPK
STTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPSFPPSETTTDATTGGPT
VTPSCANANFYPAANCNQYYMCNQGTPILMTCPSGTVWVQEGIRCDWPAASTRAECRSA
Sequence Info Allergen Name Length Opt Bits Score E Value
AII81930 Bla g 12.0101 539 3750 861.0 0
Q4JK69 Der p 15.0101 532 811 191.1 1.4e-49
AAD52672 Der f 15.0101 555 804 189.5 4.4e-49
Q4JK70 Der p 15.0102 558 785 185.2 9e-48
AKH04311 Per a 12.0101 407 642 152.6 4e-38
AAM19082 Der f 18.0101 462 277 69.4 5.2e-13
Q4JK71 Der p 18.0101 462 277 69.4 5.2e-13
ALU66112 Der f 23.0101 174 120 34.1 0.0083
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 12.0101 Sequence ID: AII81930

 Score = 861.0 bits 3750,  Expect = 0
 Identities = 539/539 100%, Positives = 539/539 100%, Gaps = 0/539 0%
Query  1    MKTSQILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLI 60
            MKTSQILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLI
Sbjct  1    MKTSQILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLI 60
Query  61   YSFIGVSNVTWGPLILDQENDVDLRGFLNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSD 120
            YSFIGVSNVTWGPLILDQENDVDLRGFLNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSD
Sbjct  61   YSFIGVSNVTWGPLILDQENDVDLRGFLNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSD 120
Query  121  KKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEG 180
            KKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEG
Sbjct  121  KKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEG 180
Query  181  KGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEG 240
            KGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEG
Sbjct  181  KGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEG 240
Query  241  YGYQALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDA 300
            YGYQALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDA
Sbjct  241  YGYQALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDA 300
Query  301  GPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMD 360
            GPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMD
Sbjct  301  GPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMD 360
Query  361  FIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVVPTLQISTTPRPEWDRPK 420
            FIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVVPTLQISTTPRPEWDRPK
Sbjct  361  FIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVVPTLQISTTPRPEWDRPK 420
Query  421  STTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPSFPPSETTTDATTGGPT 480
            STTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPSFPPSETTTDATTGGPT
Sbjct  421  STTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPSFPPSETTTDATTGGPT 480
Query  481  VTPSCANANFYPAANCNQYYMCNQGTPILMTCPSGTVWVQEGIRCDWPAASTRAECRSA 539
            VTPSCANANFYPAANCNQYYMCNQGTPILMTCPSGTVWVQEGIRCDWPAASTRAECRSA
Sbjct  481  VTPSCANANFYPAANCNQYYMCNQGTPILMTCPSGTVWVQEGIRCDWPAASTRAECRSA 539

Sequence Alignment: 2. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 191.1 bits 811,  Expect = 1e-49
 Identities = 196/499 39%, Positives = 296/499 59%, Gaps = 56/499 11%
Query  1    MKTS---QILFLC-GVVFLSVLVSTSG--DKPSRVVCYFSNWAVYRPGLGSYKIEDIPTD 54
            MKTS    IL  C G++  +V    +     P R+VCY   W+VY   +  Y IEDI   
Sbjct  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHK-VDPYTIEDIDPF 59
Query  55   LCTHLIYSFIGVSNVTW-----GPLILDQENDVDLRGFLNFTDLKAKG--VKTSVAMGGW 107
             CTHL+Y F  +    +      P   D  N  +  G+  F +L+ K   + T +++GGW
Sbjct  60   KCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGW 119
Query  108  GEGGRKYSHLVSDKKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFY 167
             EG  KYS +V++   R  F+ ++++FL++Y FDGLD+DWEYPG S  G    D+QN++ 
Sbjct  120  YEGSEKYSDMVANPTYRKQFVQSVLDFLQEYKFDGLDLDWEYPG-SRLGNPKIDKQNYLT 178
Query  168  FVEELRRAFDKEGKGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFA 227
            +V EL+ AF  E  G+ +T AV     +++  Y + +L +L D ++VM YD  G W    
Sbjct  179  LVRELKEAF--EPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVF 236
Query  228  DVHSPLYQRPNEGYGYQA-LNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKD 286
              ++PLY+RP+E    +  +N N  M+ +++ G + DKLV+G PFYGR +++   +  K 
Sbjct  237  GHNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVK- 295
Query  287  IGTYINKDAGGGDAGPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQW 346
            +G   +   G    G  TG +G+L+Y E+C ++Q    +W  ++D+    PY Y+D   W
Sbjct  296  LG---DPAKGMSPPGFITGEEGVLSYIELCQLFQ--KEEWHIQYDEYYNAPYGYND-KIW 349
Query  347  VGYDNEISLQYKMDFIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVVPTL 406
            VGYD+  S+  K+ F+KE G  G M W+++ DDF G CG K PL+N +  NM        
Sbjct  350  VGYDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKV-HNM-------- 400
Query  407  QISTTPRPEWDRPKSTTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPSFP 466
             I+   +  ++      + G S TT T TT +  +T   T TT +T ST  PT TTPS P
Sbjct  401  -INGDEKNSYE-----CLLGPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTP 454
Query  467  ----PSETTTDATTGGPTVTP-------SCANANFYP-AANCNQYYMC---NQGTPI-LM 510
                P+ TTTD+T+  P  T         C      P   N ++Y +C   N G  + +M
Sbjct  455  STTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIM 514
Query  511  TCPSGTVWVQEGIRC 525
             CP GT+W QE + C
Sbjct  515  PCPPGTIWCQEKLTC 529

Sequence Alignment: 3. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 189.5 bits 804,  Expect = 4e-49
 Identities = 188/489 38%, Positives = 284/489 58%, Gaps = 43/489 8%
Query  26   PSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIGVSNVTW-----GPLILDQEN 80
            P R+VCY   W+VY   +  Y IEDI    CTHL+Y F  +    +      P   D  N
Sbjct  32   PMRIVCYVGTWSVYHK-VDPYTIEDIDPFKCTHLMYGFAKIDEYKYTIQVFDPYQDDNHN 90
Query  81   DVDLRGFLNFTDLKAKG--VKTSVAMGGWGEGGRKYSHLVSDKKLRDTFIPALVEFLHKY 138
              + RG+  F +L+ K   + T +++GGW EG  KYS + ++   R  FI ++++FL++Y
Sbjct  91   SWEKRGYERFNNLRLKNPELTTMISLGGWYEGSEKYSDMAANPTYRQQFIQSVLDFLQEY 150
Query  139  NFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWEITMAVPLANFRLNE 198
             FDGLD+DWEYPG S  G    D+QN++ +V EL+ AF  E  G+ +T AV     +++ 
Sbjct  151  KFDGLDLDWEYPG-SRLGNPKIDKQNYLALVRELKDAF--EPHGYLLTAAVSPGKDKIDR 207
Query  199  GYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEGYGYQA-LNDNDGMQLWVD 257
             Y + +L +L D ++VM YD  G W  F   ++PLY+RP+E    +  +N N  M+ +++
Sbjct  208  AYDIKELNKLFDWMNVMTYDYHGGWENFYGHNAPLYKRPDETDELHTYFNVNYTMHYYLN 267
Query  258  KGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYTGAKGMLAYYEICN 317
             G + DKLV+G PFYGR +++ +  +   +G   +   G    G  +G +G+L+Y E+C 
Sbjct  268  NGATRDKLVMGVPFYGRAWSI-EDRSKLKLG---DPAKGMSPPGFISGEEGVLSYIELCQ 323
Query  318  MLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMDFIKEKGYLGAMTWAIDM 377
            ++Q    +W  ++D+    PY Y+D   WVGYD+  S+  K+ F+KE G  G M W+++ 
Sbjct  324  LFQ--KEEWHIQYDEYYNAPYGYND-KIWVGYDDLASISCKLAFLKELGVSGVMVWSLEN 380
Query  378  DDFHGTCGQKNPLINVL-------AKNMKDYVVPTLQISTTPRPEWDRPKSTTFEGGSVT 430
            DDF G CG KNPL+N +        KN  + ++     + TP      P +T       T
Sbjct  381  DDFKGHCGPKNPLLNKVHNMINGDEKNSFECILGPSTTTPTPTTTPTTPTTTPTTPSPTT 440
Query  431  TSTTTTTTMKTTIPETTTTGTTTSTIDPTITTPS-FP----PSETTTDATTGGPTVTP-- 483
             +TT + T  TT P  TT  TT S   PT TTP+  P    PS TTT+ T+  P  T   
Sbjct  441  PTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTSTPSPTTTEHTSETPKYTTYV 500
Query  484  -----SCANANFYP-AANCNQYYMC---NQGTPI-LMTCPSGTVWVQEGIRC 525
                  C      P   N ++Y +C   N G  + +M CP GT+W QE + C
Sbjct  501  DGHLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCPPGTIWCQEKLTC 552

Sequence Alignment: 4. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 185.2 bits 785,  Expect = 9e-48
 Identities = 202/514 39%, Positives = 300/514 58%, Gaps = 52/514 10%
Query  1    MKTS---QILFLC-GVVFLSVLVSTSG--DKPSRVVCYFSNWAVYRPGLGSYKIEDIPTD 54
            MKTS    IL  C G++  +V    +     P R+VCY   W+VY   +  Y IEDI   
Sbjct  1    MKTSCAILILMACFGLMNAAVKRDHNNYSKNPMRIVCYVGTWSVYHK-VDPYTIEDIDPF 59
Query  55   LCTHLIYSFIGVSNVTW-----GPLILDQENDVDLRGFLNFTDLKAKG--VKTSVAMGGW 107
             CTHL+Y F  +    +      P   D  N  +  G+  F +L+ K   + T +++GGW
Sbjct  60   KCTHLMYGFAKIDEYKYTIQVFDPYQDDNHNTWEKHGYERFNNLRLKNPELTTMISLGGW 119
Query  108  GEGGRKYSHLVSDKKLRDTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFY 167
             EG  KYS +V++   R  F+ ++++FL++Y FDGLD+DWEYPG S  G    D+QN++ 
Sbjct  120  YEGSEKYSDMVANPTYRQQFVQSVLDFLQEYKFDGLDLDWEYPG-SRLGNPKIDKQNYLT 178
Query  168  FVEELRRAFDKEGKGWEITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFA 227
            +V EL+ AF  E  G+ +T AV     +++  Y + +L +L D ++VM YD  G W    
Sbjct  179  LVRELKEAF--EPFGYLLTAAVSPGKDKIDVAYELKELNQLFDWMNVMTYDYHGGWENVF 236
Query  228  DVHSPLYQRPNEGYGYQA-LNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKD 286
              ++PLY+RP+E    +  +N N  M+ +++ G + DKLV+G PFYGR +++   +  K 
Sbjct  237  GHNAPLYKRPDETDELHTYFNVNYTMHYYLNNGATRDKLVMGVPFYGRAWSIEDRSKVK- 295
Query  287  IGTYINKDAGGGDAGPYTGAKGMLAYYEICNMLQVNASKWTQKFDDIGKCPYAYDDGNQW 346
            +G   +   G    G  TG +G+L+Y E+C ++Q    +W  ++D+    PY Y+D   W
Sbjct  296  LG---DPAKGMSPPGFITGEEGVLSYIELCQLFQ--KEEWHIQYDEYYNAPYGYND-KIW 349
Query  347  VGYDNEISLQYKMDFIKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVL-------AKNMK 399
            VGYD+  S+  K+ F+KE G  G M W+++ DDF G CG K PL+N +        KN  
Sbjct  350  VGYDDLASISCKLAFLKELGVSGVMIWSLENDDFKGHCGPKYPLLNKVHNMINGDEKNSY 409
Query  400  DYVV-P--TLQISTTPR-PEWDRPKSTTFEGGSVTTSTTTTTTMKTTIPETTTTGTTTST 455
            + ++ P  T    TTP  P    P  TT    S TT T TT +  +T   T TT +T ST
Sbjct  410  ECLLGPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPST 469
Query  456  IDPTITTPSFP----PSETTTDATTGGPTVTP-------SCANANFYP-AANCNQYYMC- 502
              PT TTPS      P+ TTTD+T+  P  T         C      P   N ++Y +C 
Sbjct  470  TTPTPTTPSTTSTTTPTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCE 529
Query  503  --NQGTPI-LMTCPSGTVWVQEGIRC 525
              N G  + +M CP GT+W QE + C
Sbjct  530  YVNGGWWVHIMPCPPGTIWCQEKLTC 555

Sequence Alignment: 5. Allergen Name: Per a 12.0101 Sequence ID: AKH04311

 Score = 152.6 bits 642,  Expect = 4e-38
 Identities = 137/357 38%, Positives = 213/357 59%, Gaps = 28/357 7%
Query  23   GDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIGVSNVTWGPLI-LDQEND 81
            GD  + V CY+ +WA YR G+ ++++++I T LCTH++Y+F G+ +   G ++ LD+ ND
Sbjct  39   GDDRA-VFCYYGSWATYRWGIATFEVDNIDTRLCTHIVYAFTGLRD---GVIVSLDEYND 94
Query  82   VDL---RGFLN-FTDL-KAKGVKTSVAMGGWGEGGRKYSHLVSDKKLRDTFIPALVEFLH 136
             +    +G++  FT L K  G+K  V +GGW EG  KYS + + +  R+TF  + V FL+
Sbjct  95   YEENWGKGLMKKFTTLAKNNGIKALVGLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQ 154
Query  137  KYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWEITMAVPLANFRL 196
            K  FDGLD+DWEYP  + RGG   D+ NF  +++ L   +    +G  +T+AV       
Sbjct  155  KQGFDGLDLDWEYP--ARRGGVPEDKDNFTLLLKTLSEKL--HARGLILTVAVSADPKTA 210
Query  197  NEGYHVPDLCELIDAVHVMAYDLRGNWAG-FADVHSPLYQRPNE-GYGYQALNDNDGMQL 254
               Y  P++ +  D + +M++D     +     ++SPL   P + GY  + LN    +  
Sbjct  211  ANAYDFPNVAKYADYITLMSFDYHTPSSDTVTGLNSPLDSLPQDTGYN-KKLNVKYSVNQ 269
Query  255  WVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYTGAKGMLAYYE 314
            W+  G  P+KLVLG P+YGRT+ L+  +    +G  I    G G AG YT   G LAYYE
Sbjct  270  WLKGGVPPNKLVLGVPLYGRTYRLADPD-QHGLGAPI---LGPGTAGLYTQEAGFLAYYE 325
Query  315  ICNMLQVNASKWTQKFDDIGKCPYAYDDGNQWVGYDNEISLQYKMDFIKEKGYLGAMTWA 374
            IC     +   W   ++D     YAY D  QW+ YD+  ++  K  ++ EK   G M W+
Sbjct  326  IC-----SNPDWNVVWNDTSSYLYAYKD-YQWLSYDDPNTITIKAQWVLEKNLGGVMVWS 379
Query  375  IDMDDFHGTCGQKN-PLINVLAKNM 398
            ++ DDFHG CG+   PL+  + K +
Sbjct  380  LESDDFHGNCGKGAYPLLTAVNKAL 404

Sequence Alignment: 6. Allergen Name: Der f 18.0101 Sequence ID: AAM19082

 Score = 69.4 bits 277,  Expect = 5e-13
 Identities = 110/357 30%, Positives = 190/357 53%, Gaps = 31/357 8%
Query  28   RVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIGVSNVTWGPLILDQENDVDLRGF 87
            + VCY+ +W  +R G G    EDI T LCTH++YS+ G+   T    +LD+    DL   
Sbjct  30   KTVCYYESWVHWRQGEGKMDPEDIDTSLCTHIVYSYFGIDAATHEIKLLDEYLMKDLHDM 89
Query  88   LNFTDLKAKGVKTSVAMGGWGEGGRKYSHLVSDKKLRDTFIPALVEFLHKYNFDGLDIDW 147
             +FT  K    K  +A+GG      ++S   + +  R+TF+ + V+++ +Y FDG+ IDW
Sbjct  90   EHFTQHKGNA-KAMIAVGG-STMSDQFSKTAAVEHYRETFVVSTVDLMTRYGFDGVMIDW 147
Query  148  EYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWEITMAVPLANFRLNEGYHVPDLCE 207
                    G    D  NF  +++++   F        +T+   +A++   + Y++P +  
Sbjct  148  S-------GMQAKDSDNFIKLLDKFDEKFAHTSFVMGVTLPATIASY---DNYNIPAISN 197
Query  208  LIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEGYGYQALNDNDGMQLWVDKGCSPDKLVL 267
             +D ++V++ D  G+WA      SP+   P +    +A +          +G    K+V+
Sbjct  198  YVDFMNVLSLDYTGSWAHTVGHASPF---PEQLKTLEAYHK---------RGAPRHKMVM 245
Query  268  GTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYTGAKGMLAYYEICNMLQVNASKWT 327
              PFY RT+ L + N  +DIG   +K +G G  G +T   G L+Y E+C  +Q   + +T
Sbjct  246  AVPFYARTWILEKMN-KQDIG---DKASGPGPRGQFTQTDGFLSYNELCVQIQAETNAFT 301
Query  328  QKFDDIGKCPYA---YDDGNQWVGYDNEISLQYKMDFIKEKGYLGAMTWAIDMDDFHGTC 384
               D      YA   + +  +W+ +++  +L  K   I ++GY G   + +  +D HG C
Sbjct  302  ITRDHDNTAIYAVYVHSNHAEWISFEDRHTLGEKAKNITQQGYAGMSVYTLSNEDVHGVC 361
Query  385  GQKNPLINVLAKNMKDYVVPTLQISTTP 412
            G KNPL++ +  N    VV    + T P
Sbjct  362  GDKNPLLHAIQSNYYHGVVTEPTVVTLP 389

Sequence Alignment: 7. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 69.4 bits 277,  Expect = 5e-13
 Identities = 115/377 30%, Positives = 202/377 53%, Gaps = 36/377 9%
Query  6    ILFLCGVVFLSVLVSTSGDKPSRVVCYFSNWAVYRPGLGSYKIEDIPTDLCTHLIYSFIG 65
            +L +    F S +         + VCY+ +W  +R G G    EDI T LC+H++YS+ G
Sbjct  8    VLIFLAAYFGSNIRPNVATLDPKTVCYYESWVHWRQGDGKMDPEDIDTSLCSHIVYSYFG 67
Query  66   VSNVTWGPLILDQENDVDLRGFLNFTDLKAKG-VKTSVAMGGWGEGGRKYSHLVSDKKLR 124
            +   +    +LDQ   + L    +FT  K KG  K  +A+GG      ++S   + +  R
Sbjct  68   IDASSHEIKLLDQYLMITLHDMEHFT--KHKGNAKAMIAVGG-ASMSDQFSKTAAVEHYR 124
Query  125  DTFIPALVEFLHKYNFDGLDIDWEYPGASDRGGSYGDRQNFFYFVEELRRAFDKEGKGWE 184
            +TF+ + ++++ KY FDG+ IDW        G    D  NF  +++++   F +      
Sbjct  125  ETFVVSTIDLMTKYGFDGVMIDWS-------GMQAKDSDNFVKLLDKFDEKFAQTSFVMG 177
Query  185  ITMAVPLANFRLNEGYHVPDLCELIDAVHVMAYDLRGNWAGFADVHSPLYQRPNEGYGYQ 244
            +T+   +A++   + Y++P +   +D ++V+  D  G WA      S L   P +    +
Sbjct  178  VTLPATIASY---DNYNIPAISNYVDFMNVLTLDYDGPWAYTVGHASAL---PEQLKTLE 231
Query  245  ALNDNDGMQLWVDKGCSPDKLVLGTPFYGRTFTLSQGNTNKDIGTYINKDAGGGDAGPYT 304
            A N          +G    K+V+  PF+ RT+ L + +  +D+G   +K +G G  G +T
Sbjct  232  AYNK---------RGAPRHKMVMAVPFFARTWILEKMD-KQDVG---DKASGPGPKGQFT 278
Query  305  GAKGMLAYYEICNMLQV--NASKWTQKFDDIG-KCPYAYDDGNQWVGYDNEISLQYKMDF 361
               G L+Y E+C  +Q   NA   T+  D+      Y +D+  +W+ +++  +L  K   
Sbjct  279  QTPGFLSYNELCVQIQAETNAFSITRDHDNTAIYAVYVHDNHAEWISFEDRHTLGDKARN 338
Query  362  IKEKGYLGAMTWAIDMDDFHGTCGQKNPLINVLAKNMKDYVV--PTLQISTTP 412
            I E+GY G   + +  +D HG CG KNPL++ +  N    +V  PT+ ++ TP
Sbjct  339  ITEQGYGGMSVYTLSNEDVHGVCGDKNPLLHAINSNYFRGIVTEPTV-VTVTP 390

Sequence Alignment: 8. Allergen Name: Der f 23.0101 Sequence ID: ALU66112

 Score = 34.1 bits 120,  Expect = 0.008
 Identities = 45/144 31%, Positives = 69/144 47%, Gaps = 9/144 6%
Query  376  DMDDFHGTCGQKNPLINVLAKNMKDYVVPTLQISTTPRPEWDRPKSTTFEGGSVTTSTTT 435
            D DD + +  + +     +       V P+   +T+      +P +TT +  S TT   T
Sbjct  27   DNDDQNSSTSRPDDDPTTMIDVQTTTVQPSSMPTTSESESTVKPTTTTVKP-SPTTVKPT 85
Query  436  TTTMKTTIPETTTTGTTTSTIDPTITTPSFPPSETTTDATTGGPTVTPSCANANFY---P 492
            TTT+K T   TTT   + +T+ PT TT    P+ TTT  TT  P     C     Y   P
Sbjct  86   TTTVKLT---TTTVKPSPTTVKPTTTTVKPSPTTTTT-TTTEQPEDEFECPTRFGYFADP 141
Query  493  AANCNQYYMCNQGTPILMTCPSGTVWVQEGIRC 525
               C ++Y+C+    I  +CP  T W ++ + C
Sbjct  142  KDPC-KFYICSNWEAIHKSCPGNTRWNEKELTC 173

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.