The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA
LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV
EQEDVIPEDWKPDTVYKSKIQF
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL14077 Cyn d 1.0202 262 1820 443.3 3.9e-126
AAL14079 Cyn d 1.0203 262 1807 440.2 3.4e-125
A0A4D6FZ45 Uro m 1.0101 262 1807 440.2 3.4e-125
AAL14078 Cyn d 1 262 1760 429.0 8.3e-122
AAK96255 Cyn d 1.0201 244 1691 412.5 7.1e-117
AAF80379 Cyn d 1.0204 244 1688 411.8 1.2e-116
QCX36431 Zoy m 1.0101 272 1523 372.1 1.1e-104
O04701 Cyn d 1 246 1496 365.7 8.4e-103
CAA10520 Poa p a 263 1259 308.9 1.2e-85
CAA10140 Hol l 1 263 1255 307.9 2.3e-85
A0A4D6G2J8 Uro m 1.0201 229 1250 306.8 4.2e-85
P43213 Phl p 1 263 1247 306.0 8.5e-85
Q41260 Pha a 1 269 1233 302.6 9e-84
P43216 Hol l 1 265 1231 302.2 1.2e-83
AAF72983 Ory s 1 267 1229 301.7 1.7e-83
CAA81613 Phl p 1.0101 263 1227 301.2 2.4e-83
CAA93121 Hol l 1.0102 248 1213 297.9 2.2e-82
AAA63278 Lol p 1.0102 252 1212 297.7 2.7e-82
CAB63699 Lol p 1.0103 263 1211 297.4 3.4e-82
P14946 Lol p 1 263 1203 295.5 1.3e-81
AAA63279 Lol p 1.0101 263 1200 294.7 2.1e-81
AAF72991 Ory s 1 267 1200 294.7 2.1e-81
ACA23876 Pas n 1.0101 265 1136 279.4 8.8e-77
P58738 Zea m 1 269 1124 276.5 6.6e-76
ABC58726 Sor h 1.0101 239 1095 269.7 6.8e-74
AAF72990 Ory s 1 269 1082 266.4 7.1e-73
Q40638 Ory s 1 263 1052 259.3 1e-70
AAF72984 Ory s 1 268 938 231.9 1.7e-62
AAF72987 Ory s 1 275 918 227.1 5e-61
Q07154 Zea m 1 191 879 218.1 1.8e-58
AAB61710 Ory s 1 261 876 217.1 4.9e-58
AAF72985 Ory s 1 286 856 212.2 1.6e-56
AAD10496 Tri a ps93 271 854 211.8 2e-56
AAF72989 Ory s 1 271 852 211.3 2.8e-56
AAA50175 Gly m 2 277 706 176.3 9.9e-46
AAF72988 Ory s 1 327 706 176.2 1.3e-45
AAF72986 Ory s 1 275 694 173.4 7.2e-45
CAB37496 Ara t expansin 265 403 103.7 6.7e-24
AAG13596 Ory s 1 275 345 89.8 1.1e-19
BAA85432 Ory s 1 284 323 84.5 4.4e-18
AAP80171 Cyn d 15 112 269 72.3 8.3e-15
P14947 Lol p 2 97 257 69.5 4.9e-14
CAA10346 Cyn d 2 122 254 68.6 1.1e-13
CAA10348 Poa p 2 122 250 67.7 2.2e-13
P43214 Phl p 2 122 250 67.7 2.2e-13
CAA10345 Dac g 2 122 250 67.7 2.2e-13
CAA51775 Lol p 2 88 237 64.8 1.2e-12
P93124 Dac g 3 96 226 62.1 8.2e-12
2JNZ_A Phl p 3.0101 108 214 59.1 7.3e-11
P14948 Lol p 3 97 192 54.0 2.4e-09
CAA90746 Tri a 3 118 188 52.8 6.2e-09
Q7M1X8 Dac g 1.0101 34 167 48.8 3e-08
A0A077B7S9 Sor h 2.0101 119 177 50.2 3.9e-08
Q7M1X6 Ant o 1.0101 32 157 46.4 1.4e-07
A0A077B2S0 Sor h 2.0201 121 161 46.3 5.8e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 443.3 bits 1820,  Expect = 4e-126
 Identities = 262/262 100%, Positives = 262/262 100%, Gaps = 0/262 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 2. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 440.2 bits 1807,  Expect = 3e-125
 Identities = 260/262 99%, Positives = 260/262 99%, Gaps = 0/262 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFD MTGCGNEPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 3. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 440.2 bits 1807,  Expect = 3e-125
 Identities = 260/262 99%, Positives = 260/262 99%, Gaps = 0/262 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFD MTGCGNEPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 4. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 429.0 bits 1760,  Expect = 8e-122
 Identities = 252/262 96%, Positives = 254/262 96%, Gaps = 0/262 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            MLA VAVVLASMVGGA CAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
Sbjct  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPFDGMTGCGNEPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGS+PNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKYAAGDGNIV VDIK KGSD FLPMK SWGAIWR+DPPKPLKGPFTIRLTSESGGHV
Sbjct  181  LLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHV 240
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
            EQEDVIPEDWKPDTVYKSKIQF
Sbjct  241  EQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 5. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 412.5 bits 1691,  Expect = 7e-117
 Identities = 240/244 98%, Positives = 242/244 99%, Gaps = 0/244 0%
Query  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  79   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
            EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGS+PNYLALLVKYAAGDGNIV VDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
             KGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  181  PKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  259  KIQF 262
            KIQF
Sbjct  241  KIQF 244

Sequence Alignment: 6. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 411.8 bits 1688,  Expect = 1e-116
 Identities = 239/244 97%, Positives = 242/244 99%, Gaps = 0/244 0%
Query  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  79   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
            EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGS+PNYLALLVKYAAGDGNIV VDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
             KGSDEFLPMKQSWGAIWR+DPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  259  KIQF 262
            KIQF
Sbjct  241  KIQF 244

Sequence Alignment: 7. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 372.1 bits 1523,  Expect = 1e-104
 Identities = 214/261 81%, Positives = 236/261 90%, Gaps = 0/261 0%
Query  2    LAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
            LA VAV+L++MVG ALC +GDKPGPNITATY ++W DAKATFYGS+PRGAAPDD GGACG
Sbjct  12   LAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACG 71
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
            YK+VDKAPF GMTGCGNEPIFKDGL CGSC+EIKCKEPAECS +PVLI+ITDKNYEHIAA
Sbjct  72   YKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAA 131
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
            YHFDLSGKAFG+MAK+G+ED LRKAGEL LQFRRVKCEYPS TKI FHVEKG N NYLAL
Sbjct  132  YHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLAL 191
Query  182  LVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE 241
            LV+YAAGDG+IV+VDIK KGSDEFLPMK SWGAIWRIDP KPLKGPFT+RLTSESG  + 
Sbjct  192  LVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLV 251
Query  242  QEDVIPEDWKPDTVYKSKIQF 262
            QEDVIP DWKP+T Y S +Q+
Sbjct  252  QEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 8. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 365.7 bits 1496,  Expect = 8e-103
 Identities = 207/244 84%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
Query  79   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
            EPIFKDGL C +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGSN +YLALLVKYAAGDGNIV+VDIK
Sbjct  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
Query  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
             + SDEF+PMK SWGAIWRIDP KPLKGPF+IRLTSE G H+ Q+DVIP +WKPDTVY S
Sbjct  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
Query  259  KIQF 262
            K+QF
Sbjct  241  KLQF 244

Sequence Alignment: 9. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 308.9 bits 1259,  Expect = 1e-85
 Identities = 181/257 70%, Positives = 205/257 79%, Gaps = 2/257 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L VVA+ +A  +G A       PGPNITATYGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  7    VLLVVAL-FAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPF GMTGCGN PIFK G  CGSC+EIKC +P  CSGEPVL+ ITD N E IA
Sbjct  65   GYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSGKAFGAMAKKGEE KLR AGEL L+FRRVKCEYP  TK+ FHVEKGSNPNYLA
Sbjct  125  AYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKY  GDG++V+VDIK KG D+++ +K+SWG+IWR+D P  L GPFT+R T+E G   
Sbjct  185  LLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKG 244
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y SK
Sbjct  245  EAEDVIPEGWKADTAYASK 263

Sequence Alignment: 10. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 307.9 bits 1255,  Expect = 2e-85
 Identities = 175/258 67%, Positives = 205/258 79%, Gaps = 1/258 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            ++ +V  ++A  +G A       PGPNITATYGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  6    LVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDK PF GMTGCGN PIFK G  CGSC+EIKC +P  CSGEP+++ ITD N E IA
Sbjct  65   GYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYH+DLSGKAFGAMAKKGEE KLR AGEL L+FRRVKCEYP  TK+ FHVEKGSNPNYLA
Sbjct  125  AYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKY  GDG++V+VDIK KG D+++ +K+SWGA+WR+D P  L GPFT+R T+E G  V
Sbjct  185  LLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKV 244
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y+SK
Sbjct  245  EAEDVIPEGWKADTAYESK 263

Sequence Alignment: 11. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 306.8 bits 1250,  Expect = 4e-85
 Identities = 172/227 75%, Positives = 200/227 88%, Gaps = 1/227 0%
Query  35   KWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEI 94
            KWLDAKAT+YG  P GA PDD+GGACGYKDV+KAPF+ M  CGN PIFKDGL CGSCYEI
Sbjct  3    KWLDAKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  95   KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFR 154
            KC +PAECSGEPV++ ITD+NYE IAAYHFDL+G AFGAMAKKGEE+KLRKAG + +QFR
Sbjct  62   KCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFR 121
Query  155  RVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGA 214
            RVKC+YP++TKIAFHVEKG NPNY+ALL+KYAAGDG+IV+VDIK KGS+EF+P+K+SWGA
Sbjct  122  RVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGA 181
Query  215  IWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            IWRID PKP+KGP  +RLTSE G  + Q+D IPE WK DTVY SK+QF
Sbjct  182  IWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 12. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 306.0 bits 1247,  Expect = 9e-85
 Identities = 176/255 69%, Positives = 201/255 78%, Gaps = 1/255 0%
Query  4    VVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYK 63
            +V V++A  +G A       PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYK
Sbjct  9    LVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYK 67
Query  64   DVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYH 123
            DVDK PF GMTGCGN PIFK G  CGSC+EIKC +P  CSGEPV++ ITD N E IA YH
Sbjct  68   DVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYH 127
Query  124  FDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLV 183
            FDLSG AFGAMAKKG+E KLR AGEL LQFRRVKC+YP  TK+ FHVEKGSNPNYLALLV
Sbjct  128  FDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLV 187
Query  184  KYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQE 243
            KY  GDG++V+VDIK KG D+++ +K+SWGAIWRID P  L GPFT+R T+E G   E E
Sbjct  188  KYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAE 247
Query  244  DVIPEDWKPDTVYKSK 259
            DVIPE WK DT Y+SK
Sbjct  248  DVIPEGWKADTSYESK 263

Sequence Alignment: 13. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 302.6 bits 1233,  Expect = 9e-84
 Identities = 176/257 68%, Positives = 200/257 77%, Gaps = 1/257 0%
Query  2    LAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
            L VVA +LA  VG A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACG
Sbjct  13   LLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACG 71
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
            YKDVDKAPF+GMTGCGN PIFKDG  CGSC+E+KC +P  CSGEP+ + ITD N E IA 
Sbjct  72   YKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEEPIAP 131
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
            YHFDLSG AFG+MAKKGEE+ +R AGEL LQFRRVKC+YP  TK  FHVEKGSNPNYLAL
Sbjct  132  YHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLAL 191
Query  182  LVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE 241
            LVKY  GDG++V+VDIK KG D+++ +K+SWGAIWRID P  L GPFT+R T+E G   E
Sbjct  192  LVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAE 251
Query  242  QEDVIPEDWKPDTVYKSK 259
             EDVIPE WK DT   SK
Sbjct  252  FEDVIPEGWKADTHDASK 269

Sequence Alignment: 14. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 302.2 bits 1231,  Expect = 1e-83
 Identities = 173/258 67%, Positives = 202/258 78%, Gaps = 1/258 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L +VA ++A  +G A       PGPNITATYGD+WLDAK+T+YG  P GA P D+GGAC
Sbjct  8    VLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGAC 66
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDK PF GMTGCGN PIFKDG  CGSC+EIKC +P  CSGEPV + ITD N E IA
Sbjct  67   GYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIA 126
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSG AFG+MAKKGEE KLR AGEL L+FRRVKC+YP  TK  FHVEKGSNPNYLA
Sbjct  127  PYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLA 186
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKY  GDG++V+VDIK KG D+++ +K+SWGA+WR+D P  L GPFT+R T+E G   
Sbjct  187  LLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKG 246
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y++K
Sbjct  247  EAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 15. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 301.7 bits 1229,  Expect = 2e-83
 Identities = 171/259 66%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            L +  VV+A+MV    C      PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGAC
Sbjct  6    LLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPF GM  CGN+PIFKDG  CGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSG AFGAMAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  125  AYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E G  +
Sbjct  185  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKI 244
Query  241  EQEDVIPEDWKPDTVYKSKIQ 261
              ED IP+ WK D+VYKS +Q
Sbjct  245  IAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 16. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 301.2 bits 1227,  Expect = 2e-83
 Identities = 175/257 68%, Positives = 206/257 80%, Gaps = 2/257 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L VVA+ +A  +G A       PGPNITATYGDKWLDAK+T+YG  P  A P D+GGAC
Sbjct  7    VLLVVAL-FAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGK-PTAAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDK PF GMTGCGN PIFK G  CGSC+EIKC +P  CSGEPV++ ITD N E IA
Sbjct  65   GYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSG AFG+MAKKG+E KLR AGE+ +QFRRVKC+YP  TK+ FHVEKGSNPNYLA
Sbjct  125  AYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVK+ AGDG++V+VDIK KG D+++ +K+SWGAIWRID P+ LKGPFT+R T+E G   
Sbjct  185  LLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKG 244
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E +DVIPE WK DT Y+SK
Sbjct  245  EAKDVIPEGWKADTAYESK 263

Sequence Alignment: 17. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 297.9 bits 1213,  Expect = 2e-82
 Identities = 167/235 71%, Positives = 191/235 81%, Gaps = 1/235 0%
Query  24   PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 83
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
Query  84   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 143
            DG  CGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
Query  144  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSD 203
            R AGEL L+FRRVKC+YP  TK  FHVEKGSNPNYLALLVKY  GDG++V+VDIK KG D
Sbjct  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
Query  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E EDVIPE WK DT Y++K
Sbjct  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248

Sequence Alignment: 18. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 297.7 bits 1212,  Expect = 3e-82
 Identities = 174/252 69%, Positives = 198/252 78%, Gaps = 5/252 1%
Query  3    AVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGY 62
            A+ AV L S  G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGY
Sbjct  1    ALFAVFLGSAHGIAKV----PPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGY 55
Query  63   KDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAY 122
            KDVDKAPF+GMTGCGN PIFKDG  CGSC+EIKC +P  CSGE V + ITD N E IA Y
Sbjct  56   KDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY 115
Query  123  HFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALL 182
            HFDLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK  FHVEKGSNPNYLA+L
Sbjct  116  HFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAIL 175
Query  183  VKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQ 242
            VKY  GDG++V+VDIK KG D+++ +K+SWGA+WRID P  L GPFT+R T+E G   E 
Sbjct  176  VKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEV 235
Query  243  EDVIPEDWKPDTVYKSK 259
            EDVIPE WK DT Y +K
Sbjct  236  EDVIPEGWKADTSYSAK 252

Sequence Alignment: 19. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 297.4 bits 1211,  Expect = 3e-82
 Identities = 174/257 67%, Positives = 200/257 77%, Gaps = 2/257 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPF+GMTGCGN PIFKDG  CGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  65   GYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSG AFG+MAKKGEE KLR AGEL LQFRRVKC+YP  TK  FHVEK SNPNYLA
Sbjct  125  PYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            +LVKY  GDG++V+VDIK KG D+++ +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  185  ILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y +K
Sbjct  245  EVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 20. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 295.5 bits 1203,  Expect = 1e-81
 Identities = 172/257 66%, Positives = 200/257 77%, Gaps = 2/257 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYK+VDKAPF+GMTGCGN PIFKDG  CGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  65   GYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK  FHVEK SNPNYLA
Sbjct  125  PYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            +LVKY  GDG++V+VDIK KG D+++ +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  185  ILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y +K
Sbjct  245  EFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 21. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 294.7 bits 1200,  Expect = 2e-81
 Identities = 172/257 66%, Positives = 199/257 77%, Gaps = 2/257 0%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYK+VDKAPF+GMTGCGN PIFKDG  CGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  65   GYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSG AFG+MAKKGEE  +R AGEL LQFRRVKC+YP DTK  FHVEK SNPNYLA
Sbjct  125  PYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            +LVKY  GDG++V+VDIK KG D++  +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  185  ILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
Query  241  EQEDVIPEDWKPDTVYKSK 259
            E EDVIPE WK DT Y +K
Sbjct  245  EFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 22. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 294.7 bits 1200,  Expect = 2e-81
 Identities = 162/259 62%, Positives = 208/259 80%, Gaps = 2/259 0%
Query  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            L +  VV A+MV    C      PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGAC
Sbjct  6    LLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKD+DKAPF GM  CGN+PIFKDG  CGSC+E+KC +P  CS +PV+I ITD N E IA
Sbjct  65   GYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSG AFGAMAK+G++++LRKAG + +QFRRV+C+YP +TK+ FHVEKGSNPNY+A
Sbjct  125  AYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            +LVKY  GDG++V V++K KGS+E+ P+ +SWGAIWRID PKPLKGPF++R+T+ES   +
Sbjct  185  VLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKL 244
Query  241  EQEDVIPEDWKPDTVYKSKIQ 261
               DVIP++WK + +YKS+IQ
Sbjct  245  VANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 23. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 279.4 bits 1136,  Expect = 9e-77
 Identities = 166/258 64%, Positives = 195/258 75%, Gaps = 4/258 1%
Query  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            +  VA VLA++V G  C      PGPNIT  Y  KWL AKAT+YG  P GA PDD+GGAC
Sbjct  7    IVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQ-PNGAGPDDNGGAC 65
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            G K+V+  P++G T CGN PIFKDG  CGSCYEI+C +P ECSG+PV + ITD NYE IA
Sbjct  66   GIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKP-ECSGQPVTVFITDMNYEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSGKAFGAMAK G  DKLR  G + L+FRRV+C+Y    KI FHVEKGSNPNYLA
Sbjct  125  PYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLA 184
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            +LVK+ A DG+IV +++K K SD + PMK SWGAIWR+D PK L  PF+IRLTSESG  V
Sbjct  185  MLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKV 243
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
              +DVIP +WKPDTVY S +QF
Sbjct  244  IAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 24. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 276.5 bits 1124,  Expect = 7e-76
 Identities = 159/260 61%, Positives = 193/260 74%, Gaps = 2/260 0%
Query  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            + VV  VLA++V G  C      PGPNIT  Y  KWL A+AT+YG  P GA   D+GGAC
Sbjct  8    IMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGAC 66
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            G K+V+  P+ GMT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA
Sbjct  67   GIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIA 126
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSGKAFG++AK G  DK+R  G + ++FRRV+C+YP+  KI FH+EKG NPNYLA
Sbjct  127  PYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLA 186
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            +LVKY A DG+IV ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V
Sbjct  187  VLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKV 246
Query  241  EQEDVIPEDWKPDTVYKSKIQF 262
              +DVIP +W+PD VY S +QF
Sbjct  247  IAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 25. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 269.7 bits 1095,  Expect = 7e-74
 Identities = 157/231 67%, Positives = 186/231 80%, Gaps = 6/231 2%
Query  25   GPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKD 84
            G NIT TYG  WL+ KAT+YG  P GA PDD+GGACGYKDV+KAPF+ M  CGN PIFKD
Sbjct  7    GKNITETYGSDWLERKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKD 65
Query  85   GLACGSCYEIKCKEP--AECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDK 142
            GL CGSC+EIKC +P  AECSGE V++ ITD NYE+IAAYHFDL+G AFGAMAKKG+E+K
Sbjct  66   GL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEK 124
Query  143  LRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGS 202
            L KAG + ++FRRVKC+Y    K+ FHVEKGSNPNYLALLVKY  GDG+IV VDIK KG 
Sbjct  125  LAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGG 182
Query  203  DEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259
            D + P+K+SWGAIWR D P P+K P T+++T+E G     +DVIPE WK DT Y +K
Sbjct  183  DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 26. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 266.4 bits 1082,  Expect = 7e-73
 Identities = 150/258 58%, Positives = 194/258 75%, Gaps = 3/258 1%
Query  4    VVAV-VLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
            V+AV V+A++VGG  C      PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG
Sbjct  9    VLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACG 67
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
             K+V+  P++GM  CGN PIFKDG  CGSCYE+KC++PA CS +PV + ITD NYE I+A
Sbjct  68   IKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISA 127
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
            YHFD+SGKAFGAMA  G+E +LRKAG + +QFRRV+C+YP   K+ FHVEKGSNPNYLA+
Sbjct  128  YHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAV 187
Query  182  LVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE 241
            LVK+ A DG+++ +D++  G   + PMK SWGAIWR+D   PLK PF+IR+T+ESG  + 
Sbjct  188  LVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLI 247
Query  242  QEDVIPEDWKPDTVYKSKIQF 262
             +DVIP +W PD +Y S +QF
Sbjct  248  AKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 259.3 bits 1052,  Expect = 1e-70
 Identities = 153/243 62%, Positives = 186/243 76%, Gaps = 5/243 2%
Query  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            L +  VV+A+MV  +        PGPNIT +YGDKWL+A+       PR  AP D+GGAC
Sbjct  6    LLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGAC 64
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            GYKDVDKAPF GM  CGN+PIFKDG  CGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
            AYHFDLSG A   MAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  125  AYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 181
Query  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E     
Sbjct  182  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRS 241
Query  241  EQEDVIPE 248
              ED IP+
Sbjct  242  SAEDAIPD 249

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 231.9 bits 938,  Expect = 2e-62
 Identities = 132/255 51%, Positives = 179/255 70%, Gaps = 8/255 3%
Query  3    AVVAVVLASMVGGALCAMGDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
            A VA +++ +V    C  G +PG N +A   T    W  A+AT+YG+ P GA PDD GGA
Sbjct  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
Query  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
            CG+K+ ++ PF  MT CGNEPIFKDG  CGSCY+I+C     CSG P  + ITD NY  +
Sbjct  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
Query  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYL 179
            + YHFDLSG AFGAMAK G+ D+LR AG + +QF+RV C +P   K+ FHVE+GSNP Y+
Sbjct  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
Query  180  ALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
            A+LV+Y  GDG++V VD+    S  + PM++SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
Query  240  VEQEDVIPEDWKPDTVYKSKIQF 262
            +    VIP +W P  VY+S +Q+
Sbjct  244  LVASQVIPANWAPMAVYRSFVQY 266

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 227.1 bits 918,  Expect = 5e-61
 Identities = 134/256 52%, Positives = 185/256 72%, Gaps = 12/256 4%
Query  3    AVVAVVLASMVGGALCAMGDKPGPNIT--ATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
            A++A++   +V G+ C  G     N++  + YG  WL A+AT+YG+ P GA PDD+GGAC
Sbjct  11   AILAILSVLVVHGS-CK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAGPDDNGGAC 67
Query  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
            G+K+V++ PF  MT CGNEPIFKDG  CGSCY+I+C +   CSG    + ITD NY  +A
Sbjct  68   GFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVA 127
Query  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
             YHFDLSG AFGAMAK G  DKLR +G + +QFRRV C YP   KI FHVE+GSNP Y+A
Sbjct  128  RYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFA 186
Query  181  LLVKYAAGDGNIVSVDI-KSKG-----SDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTS 234
            +LV+Y   DG++V VD+ +SK      +  + PM++SWG+IWR+D    L+ PF++R+ S
Sbjct  187  VLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRS 246
Query  235  ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            +SG  +   +VIP +W P++ Y+S +QF
Sbjct  247  DSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 30. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 218.1 bits 879,  Expect = 2e-58
 Identities = 121/190 63%, Positives = 148/190 77%, Gaps = 0/190 0%
Query  73   MTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 132
            MT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  133  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNI 192
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG NPNY+A+LVK+ A DG+I
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  193  VSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKP 252
            V ++I+ K S E+ PMK SWGAIWR+D  K LKGPF+IRLTSESG  V  +D+IP +W+P
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  253  DTVYKSKIQF 262
            D VY S +QF
Sbjct  181  DAVYTSNVQF 190

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 217.1 bits 876,  Expect = 5e-58
 Identities = 127/255 49%, Positives = 172/255 67%, Gaps = 11/255 4%
Query  2    LAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
            +A  +  + +M+   L   G   G      Y + WL AKAT+YG  P GA PDD+GGACG
Sbjct  1    MAGASAKVVAMLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGACG 55
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
            +K+ ++ PF  MT CGNEP+F+DG  CG+CY+I+C     CSG+P  + ITD NY  +A 
Sbjct  56   FKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVAR 115
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
            YHFDLSG AFGAMA+ G  D+LR AG + +QFRRV C Y     + FHVE GSNP YLA+
Sbjct  116  YHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAV 174
Query  182  LVKYAAGDGNIVSVDI-----KSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSES 236
            LV++A  DG +V +D+       K +  + PM++SWG+IWR+D    L+GP ++R+ SES
Sbjct  175  LVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSES 234
Query  237  GGHVEQEDVIPEDWKPDTVYKSKIQF 262
            G  V    VIP +W+ +T Y SK+QF
Sbjct  235  GQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 212.2 bits 856,  Expect = 2e-56
 Identities = 119/231 51%, Positives = 166/231 71%, Gaps = 8/231 3%
Query  30   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 89
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF  MT CGN+P+FKDG  CG
Sbjct  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
Query  90   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 149
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
Query  150  MLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSKG-----SD 203
             ++F RV CE+P   KI FHVE+ SNP Y+A+LV+Y  GDG++V VD+ +SK      + 
Sbjct  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
Query  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +   +VIP +W+P+T Y+S +Q+
Sbjct  227  KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 33. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 211.8 bits 854,  Expect = 2e-56
 Identities = 124/256 48%, Positives = 177/256 69%, Gaps = 11/256 4%
Query  3    AVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGY 62
            A+  V L SM+  ++ +  +     +  +Y   WL AKAT+YG+ P GA PDD+GGACG+
Sbjct  8    AIALVALLSMLFTSVRSAVNYD-TAVARSYTSGWLPAKATWYGA-PNGAGPDDNGGACGF 65
Query  63   KDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCK---EPAECSGEPVLIKITDKNYEHI 119
            K+V++ P   M  CGNEPIF  G  CG CYEIKC+    P+ CSG+P  I ITD NY  +
Sbjct  66   KNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPS-CSGQPRRIVITDMNYYPV 124
Query  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYL 179
            A YH+DLSG AFG+MAK G  D+LR AG + +QFRRV C +P   K+ FHV++GSNPNYL
Sbjct  125  ARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPG-MKVTFHVQRGSNPNYL 183
Query  180  ALLVKYAAGDGNIVSVDI----KSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSE 235
            A+LV+Y   DG +V +++      + +  +  M++SWG++WR+D  +P++GPF+IR+TS+
Sbjct  184  AVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSD 243
Query  236  SGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            +G  +   + IP  W+ D  Y S +QF
Sbjct  244  TGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 211.3 bits 852,  Expect = 3e-56
 Identities = 120/257 46%, Positives = 171/257 66%, Gaps = 6/257 2%
Query  4    VVAVVLASMVGGALCAMGDKPGPNITATYGDK--WLDAKATFYGSDPRGAAPDDHGGACG 61
            ++ +V+     G+    G+    N +   G    W +AKAT+YG  P GA   D+GGACG
Sbjct  9    LLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQ-PNGAGAADNGGACG 67
Query  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
            +K V++ PF GMT CGN+P++K G  CGSCY ++C     CSG    + ITD NY  ++ 
Sbjct  68   FKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQ 127
Query  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
            YHFDLSG AFG +AK G  D LR+AG + +QF RV CE+P   K+ FHVE+GS+P YLA+
Sbjct  128  YHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAV 186
Query  182  LVKYAAGDGNIVSVDIKSKGSD--EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
            LV+Y  GDG++  VD+K  G+    + PM++SWG++WR+D    L+ PF+IR+ S+SG  
Sbjct  187  LVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKT 246
Query  240  VEQEDVIPEDWKPDTVYKSKIQF 262
            +   DVIP +W P+T Y+S +Q+
Sbjct  247  LVAPDVIPLNWTPNTFYRSFVQY 269

Sequence Alignment: 35. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 176.3 bits 706,  Expect = 1e-45
 Identities = 112/255 43%, Positives = 159/255 62%, Gaps = 16/255 6%
Query  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATY----GDKWLDAKATFYGSDPRGAAPDDH 56
            +L ++A++   +V  ++C     P     A+Y       W  A AT+YG  P        
Sbjct  12   LLTLIAILSIFLVIPSFCF---NPKKLYNASYYSPSSSDWSPAVATWYG--P-ANGDGSE 65
Query  57   GGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK- 114
            GGACGY + V + PF  +   G+  I+  G  CGSCYE+KC   + CSG PV + ITD+ 
Sbjct  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
Query  115  -NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKG 173
                  A YHFDLSG AFGAMA  G+++ LR AG++ +Q RR++C YP  + IAFHV+ G
Sbjct  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
Query  174  SNPNYLALLVKYAAGDGNIVSVDIKSK-GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRL 232
            SN  Y+A LV+Y  GDG++  V++K    S  +  M+QSWGA+W+ D   PL+ PF+I+L
Sbjct  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
Query  233  TS-ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            T+ ESG  +   +VIP  W P   Y+S + F
Sbjct  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 176.2 bits 706,  Expect = 1e-45
 Identities = 130/228 57%, Positives = 172/228 75%, Gaps = 12/228 5%
Query  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCY 92
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG  CGSCY
Sbjct  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
Query  93   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 152
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
Query  153  FRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-----KSKGSDE--- 204
            FRRV C+YP  T + FHVE+GSNP Y+A+LV+Y  GDG++V VD+      + G D    
Sbjct  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
Query  205  --FLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
              + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  + VIP DW+P+TVY S +QF
Sbjct  267  GVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 173.4 bits 694,  Expect = 7e-45
 Identities = 108/225 48%, Positives = 146/225 64%, Gaps = 12/225 5%
Query  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSC 91
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G  CGSC
Sbjct  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
Query  92   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 148
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
Query  149  LMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-KSKGSDEFLP 207
            L +Q++RV C +  +  +AF V+ GSNP YLA+LV+YA GDG++ +V I K++G   +  
Sbjct  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
Query  208  MKQSWGAIWRIDPP--KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            M+QSWGA WR++    KPL  PF+IRLTS SG  +   +VIP  W+    Y+S + +
Sbjct  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 103.7 bits 403,  Expect = 7e-24
 Identities = 77/224 34%, Positives = 120/224 53%, Gaps = 15/224 6%
Query  29   TATYGDKWL-DAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLA 87
            +A   D+ L  +KA ++ S     A     GAC Y  +    F G        I+KDG  
Sbjct  18   SAAACDRCLHSSKAAYFSS-----ASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSG 72
Query  88   CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKK--GEEDKLRK 145
            CG+C++++CK P  CS +   + +TD N  +     + LS +AF AMAK   G +  L K
Sbjct  73   CGACFQVRCKNPTLCSSKGTTVIVTDLNKTNQT--DLVLSSRAFRAMAKPVVGADRDLLK 130
Query  146  AGELMLQFRRVKCEYPSDTKIAFHVEKGS-NPNYLALLVKYAAGDGNIVSVDIKSKGSDE 204
             G + +++RRV C+Y  + K+   VE+ S NPNYLA+ + Y  G   +V++ I   GS  
Sbjct  131  QGIVDIEYRRVPCDY-GNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH 189
Query  205  FLPMKQSWGAIWRID--PPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQ 261
            +  M +S GA+W  D  P   L+  F +      G  V  + V+P +W+    Y + +Q
Sbjct  190  WSYMTRSHGAVWVTDKVPNGALQFRFVVT-AGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 89.8 bits 345,  Expect = 1e-19
 Identities = 62/202 30%, Positives = 106/202 52%, Gaps = 10/202 4%
Query  56   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK 114
            + G+CGY  +  A F+G       P +F+ G+ CG+C++++CK+   CS     + +TD+
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
Query  115  NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGS 174
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE+ S
Sbjct  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
Query  175  NPNY-LALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRID--PPKPLKGPFTIR 231
             P   L++   Y  G  +IV+VD+ + GS  +  M + +G  W     P  PL+  F + 
Sbjct  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
Query  232  LTSESGGHVEQED--VIPEDWKPDTVYKSKIQ 261
            +T    G     D  V+P  W    VY + +Q
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 84.5 bits 323,  Expect = 4e-18
 Identities = 80/249 32%, Positives = 127/249 51%, Gaps = 36/249 14%
Query  1    MLAVVAVVLASMV--GGALCAM--GDKPGPNITATYGDK-WLDAKATFYGSDPRGAAPDD 55
            + A +AV  A+ V   G    +    +P P     Y    W D  ATFYG DP G   DD
Sbjct  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DD 69
Query  56   HGGACGYKDVDKAP-FDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECS-GEP-VLIKIT 112
             GGACGY   D    +   T   + P+F DG  CG CYE++C +   C+ G P V+I  T
Sbjct  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
Query  113  ------------DKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY 160
                        D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+ 
Sbjct  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
Query  161  PSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK-SKGSDEFLPMKQSWGAIWRID 219
                +  ++     N  +L L V    G G++ S+ +K S G   ++   ++WG  +++ 
Sbjct  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
Query  220  PPKPLKGPFTIRLTSESGGH--VEQEDVIPEDWKPDTVYKSKIQF 262
                    +T++LT+ S  +  +   D I   W     Y+    F
Sbjct  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283

Sequence Alignment: 41. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 72.3 bits 269,  Expect = 8e-15
 Identities = 47/90 52%, Positives = 64/90 71%, Gaps = 7/90 7%
Query  166  IAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLK 225
            I FHVE+ S+P + AL +K +A +  I  VD++  G+D   PM +S G  W ID  KPLK
Sbjct  22   IIFHVEE-SSPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  226  GPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262
            GP+ IRL +E GG   Q+DVIPE+WK  T Y +K++F
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 42. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 69.5 bits 257,  Expect = 5e-14
 Identities = 39/92 42%, Positives = 56/92 60%, Gaps = 0/92 0%
Query  166  IAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLK 225
            + F VEKGS+   LAL +KY     ++  V++K  GS+E+L +K++   +W I   KPLK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  226  GPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257
            GPF  R+ SE G     +DV+P D+K  T YK
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 43. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 68.6 bits 254,  Expect = 1e-13
 Identities = 39/90 43%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
            K+ F VEKGSN  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            KGPF  R+ +E G     +DV+PE +     Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 67.7 bits 250,  Expect = 2e-13
 Identities = 38/90 42%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
            K+ F VEKGSN  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            +GPF  R+ +E G     +DV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 67.7 bits 250,  Expect = 2e-13
 Identities = 38/90 42%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
            K+ F VEKGSN  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            +GPF  R+ +E G     +DV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 67.7 bits 250,  Expect = 2e-13
 Identities = 38/90 42%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
            K+ F VEKGSN  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
            +GPF  R+ +E G     +DV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 64.8 bits 237,  Expect = 1e-12
 Identities = 37/87 42%, Positives = 53/87 60%, Gaps = 0/87 0%
Query  168  FHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGP 227
            F VEKGS+   LAL +KY+     +  V++K  GS+E+L +K++   +W I   KPLKGP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  228  FTIRLTSESGGHVEQEDVIPEDWKPDT 254
            F  R+ SE G     +DV+P D+K  T
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 62.1 bits 226,  Expect = 8e-12
 Identities = 34/91 37%, Positives = 52/91 57%, Gaps = 1/91 1%
Query  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
            K+ F VEKGS+P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256
             GPF  R+ S+ G     ++VIP  +K  T Y
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 49. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 59.1 bits 214,  Expect = 7e-11
 Identities = 32/95 33%, Positives = 53/95 55%, Gaps = 1/95 1%
Query  162  SDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPP 221
            S  ++ F V+KGS+P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
Query  222  KPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257
            KPL GPF  R+ S+ G     ++VIP  +     YK
Sbjct  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 54.0 bits 192,  Expect = 2e-09
 Identities = 30/83 36%, Positives = 47/83 56%, Gaps = 1/83 1%
Query  164  TKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKP 223
            TK+ + VEKGS+   L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
Query  224  LKGPFTIRLTSESGGHVEQEDVIP 247
            L GP   R+ S+ G     ++VIP
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIP 83

Sequence Alignment: 51. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 52.8 bits 188,  Expect = 6e-09
 Identities = 29/92 31%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
            K+ + V+KGS+   LAL + Y   + ++  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYK 257
             GPF  R+ S++G     ++V   D+K    Y+
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYE 115

Sequence Alignment: 52. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 48.8 bits 167,  Expect = 3e-08
 Identities = 24/29 82%, Positives = 26/29 89%, Gaps = 1/29 3%
Query  24   PGPNITATYGDKWLDAKATFYGSDPRGAAP 53
            PGPNITATYGDKWLDAK+T+YG  P GA P
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGAGP 34

Sequence Alignment: 53. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 50.2 bits 177,  Expect = 4e-08
 Identities = 32/93 34%, Positives = 57/93 61%, Gaps = 6/93 6%
Query  164  TKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLP-MKQSWGAIWRIDPPK 222
            T + + + K S    L L+   A+ D  +  V +K KG+ +F   +K+S    +  +  +
Sbjct  25   TLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  223  PLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQ 261
            P+KGP+++R+  +  G+   +DVIP D+KP +VYK+K Q
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQ 118

Sequence Alignment: 54. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 46.4 bits 157,  Expect = 1e-07
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  24   PGPNITATYGDKWLDAKATFYGSDPRGA 51
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32

Sequence Alignment: 55. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 46.3 bits 161,  Expect = 6e-07
 Identities = 30/93 32%, Positives = 52/93 55%, Gaps = 6/93 6%
Query  164  TKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLP-MKQSWGAIWRIDPPK 222
            T +   V K S    L+L+   A     I  V +K KG+ +F   +K+S    + +D  +
Sbjct  27   TTLTIEVGKDSTSTKLSLITNVA-----ISEVSVKPKGATDFTDDLKESEPKTFTLDSKE 81
Query  223  PLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQ 261
            P++GP   R+ ++ GG+   ++ IP D+K  +VYK+  Q
Sbjct  82   PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQ 120

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.