The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK
NCVDAKMTEEDKENALSLLDKIYTSPLC
Sequence Info Allergen Name Length Opt Bits Score E Value
AAC41617 Fel d 1 88 585 160.3 7e-42
P30439 Fel d 1 88 581 159.3 1.5e-41
CAA44343 Fel d 1 88 476 131.6 3.1e-33
AAC37318 Fel d 1 92 471 130.3 7.9e-33
P30438 Fel d 1 92 467 129.3 1.6e-32
CAA44344 Fel d 1 92 467 129.3 1.6e-32
Q9GK67 Ory c 3.B.0101 90 92 30.4 0.0089
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fel d 1 Sequence ID: AAC41617

 Score = 160.3 bits 585,  Expect = 7e-42
 Identities = 88/88 100%, Positives = 88/88 100%, Gaps = 0/88 0%
Query  1    MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK 60
            MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK
Sbjct  1    MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK 60
Query  61   NCVDAKMTEEDKENALSLLDKIYTSPLC 88
            NCVDAKMTEEDKENALSLLDKIYTSPLC
Sbjct  61   NCVDAKMTEEDKENALSLLDKIYTSPLC 88

Sequence Alignment: 2. Allergen Name: Fel d 1 Sequence ID: P30439

 Score = 159.3 bits 581,  Expect = 1e-41
 Identities = 87/88 98%, Positives = 88/88 100%, Gaps = 0/88 0%
Query  1    MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK 60
            MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK
Sbjct  1    MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK 60
Query  61   NCVDAKMTEEDKENALSLLDKIYTSPLC 88
            NCVDAKMTEEDKENALS+LDKIYTSPLC
Sbjct  61   NCVDAKMTEEDKENALSVLDKIYTSPLC 88

Sequence Alignment: 3. Allergen Name: Fel d 1 Sequence ID: CAA44343

 Score = 131.6 bits 476,  Expect = 3e-33
 Identities = 73/83 87%, Positives = 76/83 91%, Gaps = 2/83 2%
Query  4    AALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCV 63
            + LP C     + DCEICPAVKRDVDLFLTGTPDEYVEQVAQY ALPVVLENARILKNCV
Sbjct  6    STLPYC--CGHSRDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCV 63
Query  64   DAKMTEEDKENALSLLDKIYTSPLC 88
            DAKMTEEDKENALS+LDKIYTSPLC
Sbjct  64   DAKMTEEDKENALSVLDKIYTSPLC 88

Sequence Alignment: 4. Allergen Name: Fel d 1 Sequence ID: AAC37318

 Score = 130.3 bits 471,  Expect = 8e-33
 Identities = 71/72 98%, Positives = 72/72 100%, Gaps = 0/72 0%
Query  17   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 76
            +CEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL
Sbjct  21   NCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 80
Query  77   SLLDKIYTSPLC 88
            SLLDKIYTSPLC
Sbjct  81   SLLDKIYTSPLC 92

Sequence Alignment: 5. Allergen Name: Fel d 1 Sequence ID: P30438

 Score = 129.3 bits 467,  Expect = 2e-32
 Identities = 70/72 97%, Positives = 72/72 100%, Gaps = 0/72 0%
Query  17   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 76
            +CEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL
Sbjct  21   NCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 80
Query  77   SLLDKIYTSPLC 88
            S+LDKIYTSPLC
Sbjct  81   SVLDKIYTSPLC 92

Sequence Alignment: 6. Allergen Name: Fel d 1 Sequence ID: CAA44344

 Score = 129.3 bits 467,  Expect = 2e-32
 Identities = 70/72 97%, Positives = 71/72 98%, Gaps = 0/72 0%
Query  17   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENAL 76
            DCEICPAVKRDVDLFLTGTPDEYVEQVAQY ALPVVLENARILKNCVDAKMTEEDKENAL
Sbjct  21   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENAL 80
Query  77   SLLDKIYTSPLC 88
            S+LDKIYTSPLC
Sbjct  81   SVLDKIYTSPLC 92

Sequence Alignment: 7. Allergen Name: Ory c 3.B.0101 Sequence ID: Q9GK67

 Score = 30.4 bits 92,  Expect = 0.009
 Identities = 17/49 34%, Positives = 23/49 46%, Gaps = 0/49 0%
Query  16   ADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVD 64
            AD   CPA   D   FL      Y +++A+Y A P  +E    +K C D
Sbjct  19   ADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKECTD 67

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2022  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.