The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLFVDEIKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTII
GPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTP
LYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVY
HNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAAS
EFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAK
MTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAG
WGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYA
GANFRKPVEPY
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A1B2H9Q1 Amb a 12.0101 431 2803 645.3 1.7e-186
A0A1B2H9Q5 Amb a 12.0102 445 2747 632.5 1.3e-182
Q9LEJ0 Hev b 9 445 2517 580.1 7.6e-167
Q9LEI9 Hev b 9 445 2501 576.4 9.5e-166
A0A2U9IY94 Cyp c 2.0101 433 1832 423.9 7.4e-120
XP_034156632 Pan h 2.0101 434 1816 420.3 9.3e-119
B5DGQ7 Sal s 2.0101 434 1810 418.9 2.4e-118
P07322 Gal d 9.0101 434 1744 403.9 8.1e-114
Q870B9 Rho m 1.0101 439 1599 370.8 7.3e-104
P42040 Cla h 6 440 1598 370.6 8.6e-104
CAA55070 Cla h 6 440 1568 363.7 9.9e-102
AAK49451 Asp f 22.0101 438 1563 362.6 2.2e-101
AAK51201 Pen c 22.0101 438 1543 358.0 5.1e-100
Q9HDT3 Alt a 5 438 1538 356.9 1.1e-99
AAK67491 Cur l 2.0101 440 1421 330.2 1.2e-91
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Amb a 12.0101 Sequence ID: A0A1B2H9Q1

 Score = 645.3 bits 2803,  Expect = 2e-186
 Identities = 431/431 100%, Positives = 431/431 100%, Gaps = 0/431 0%
Query  1    MLFVDEIKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTII 60
            MLFVDEIKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTII
Sbjct  1    MLFVDEIKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTII 60
Query  61   GPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTP 120
            GPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTP
Sbjct  61   GPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTP 120
Query  121  LYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVY 180
            LYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVY
Sbjct  121  LYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVY 180
Query  181  HNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAAS 240
            HNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAAS
Sbjct  181  HNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAAS 240
Query  241  EFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAK 300
            EFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAK
Sbjct  241  EFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAK 300
Query  301  MTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAG 360
            MTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAG
Sbjct  301  MTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAG 360
Query  361  WGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYA 420
            WGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYA
Sbjct  361  WGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYA 420
Query  421  GANFRKPVEPY 431
            GANFRKPVEPY
Sbjct  421  GANFRKPVEPY 431

Sequence Alignment: 2. Allergen Name: Amb a 12.0102 Sequence ID: A0A1B2H9Q5

 Score = 632.5 bits 2747,  Expect = 1e-182
 Identities = 422/425 99%, Positives = 424/425 99%, Gaps = 0/425 0%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTIIGPALVG 66
            ++VDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTIIGPALVG
Sbjct  21   VEVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTIIGPALVG 80
Query  67   KDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYKHIA 126
            KDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAV LAVCKAGASVLKTPLYKHIA
Sbjct  81   KDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSLAVCKAGASVLKTPLYKHIA 140
Query  127  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSV 186
            NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSV
Sbjct  141  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSV 200
Query  187  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYGEK 246
            IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYGEK
Sbjct  201  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYGEK 260
Query  247  DKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECG 306
            DKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECG
Sbjct  261  DKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECG 320
Query  307  EQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMAS 366
            EQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMAS
Sbjct  321  EQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMAS 380
Query  367  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK 426
            HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK
Sbjct  381  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK 440
Query  427  PVEPY 431
            PVEPY
Sbjct  441  PVEPY 445

Sequence Alignment: 3. Allergen Name: Hev b 9 Sequence ID: Q9LEJ0

 Score = 580.1 bits 2517,  Expect = 8e-167
 Identities = 386/424 91%, Positives = 401/424 94%, Gaps = 1/424 0%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTIIGPALVG 66
            ++ D+ LSDG LARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAV NVN IIGPALVG
Sbjct  22   VEADVKLSDGYLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVENVNIIIGPALVG 81
Query  67   KDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYKHIA 126
            KDPTDQ GIDNFMVQQLDGT NEWGWCKQKLGANAILAV LAVCKAGA V   PLY+HIA
Sbjct  82   KDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYEHIA 141
Query  127  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSV 186
            NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GASSFKEAMKMG EVYH+LKSV
Sbjct  142  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYHHLKSV 201
Query  187  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYGEK 246
            IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYT KVVIGMDVAASEFYG  
Sbjct  202  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKVVIGMDVAASEFYG-S 260
Query  247  DKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECG 306
            D+TYDLNFKEENN+G +KISGE LKDLYKSFV+EYPIVSIEDPFDQDDW HYAK+T+E G
Sbjct  261  DQTYDLNFKEENNNGSQKISGEALKDLYKSFVAEYPIVSIEDPFDQDDWAHYAKLTSEIG 320
Query  307  EQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMAS 366
            E+VQIVGDDLLVTNP RV+KAI EK CNALLLKVNQIGSVTESIEAV+MSK AGWGVMAS
Sbjct  321  EKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMAS 380
Query  367  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK 426
            HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK
Sbjct  381  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK 440
Query  427  PVEPY 431
            PVEPY
Sbjct  441  PVEPY 445

Sequence Alignment: 4. Allergen Name: Hev b 9 Sequence ID: Q9LEI9

 Score = 576.4 bits 2501,  Expect = 1e-165
 Identities = 383/424 90%, Positives = 399/424 94%, Gaps = 1/424 0%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTIIGPALVG 66
            ++ D+ LSDG LARAAVP GASTGIYEALELRDGGSDYLGKGVSKAV NVN IIGPALVG
Sbjct  22   VEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYLGKGVSKAVENVNIIIGPALVG 81
Query  67   KDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYKHIA 126
            KDPTDQ GIDNFMVQQLDGT NEWGWCKQKLGANAILAV LAVCKAGA V   PLYKH+A
Sbjct  82   KDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYKHVA 141
Query  127  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSV 186
            NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GASSFKEAMKMG EVYH+LKSV
Sbjct  142  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYHHLKSV 201
Query  187  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYGEK 246
            IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYT KVVIGMDVAASEFYG  
Sbjct  202  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKVVIGMDVAASEFYG-S 260
Query  247  DKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECG 306
            DKTYDLNFKEENN+G +KISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWEHYAK+T+E G
Sbjct  261  DKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKLTSEIG 320
Query  307  EQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMAS 366
             +VQIVGDDLLVTNP RV+KAI EK CNALLLKVNQIGSVTESIEAV+MSK AGWGVMAS
Sbjct  321  VKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMAS 380
Query  367  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK 426
            HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGANFR 
Sbjct  381  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRT 440
Query  427  PVEPY 431
            PVEPY
Sbjct  441  PVEPY 445

Sequence Alignment: 5. Allergen Name: Cyp c 2.0101 Sequence ID: A0A2U9IY94

 Score = 423.9 bits 1832,  Expect = 7e-120
 Identities = 285/409 69%, Positives = 343/409 83%, Gaps = 15/409 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VD+  + G + RAAVPSGASTG++EALELRDG  + YLGKG  KAV +VN  I P L+
Sbjct  20   VEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKTRYLGKGTQKAVDHVNKEIAPKLI 78
Query  66   GKDPT--DQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             K  +  +Q  ID FM++ LDGT+N     K K+GANAIL V LAVCKAGA+    PLY+
Sbjct  79   EKKFSVVEQEKIDKFMLE-LDGTEN-----KSKFGANAILGVSLAVCKAGAAEKGVPLYR 132
Query  124  HIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNL 183
            HIA+LAGNK+++LPVPAFNVINGGSHAGNKLAMQEFMILP+GA +F EAM++G EVYHNL
Sbjct  133  HIADLAGNKDVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAKNFHEAMRIGAEVYHNL 192
Query  184  KSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFY 243
            K+VIK KYG+DATNVGDEGGFAPNI EN E LELLK+AI KAGY DK++IGMDVAASEF+
Sbjct  193  KNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYPDKIIIGMDVAASEFF 252
Query  244  GEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTA 303
              K+  YDL+FK  + D K  I+G+QL DLYKSF+  YP+ SIEDPFDQDDWE+++K T 
Sbjct  253  --KNGKYDLDFKSPD-DPKRHITGDQLGDLYKSFIKNYPVQSIEDPFDQDDWENWSKFTG 309
Query  304  ECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGV 363
                 +Q+VGDDL VTNP R+++A ++K CN LLLKVNQIGSVTESI+A ++++  GWGV
Sbjct  310  SV--DIQVVGDDLTVTNPKRIQQACEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGV 367
Query  364  MASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAN 423
            M SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQL+RIEEELG +A +AG +
Sbjct  368  MVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDKAKFAGKD 427
Query  424  FRKP 427
            FR P
Sbjct  428  FRHP 431

Sequence Alignment: 6. Allergen Name: Pan h 2.0101 Sequence ID: XP_034156632

 Score = 420.3 bits 1816,  Expect = 9e-119
 Identities = 282/409 68%, Positives = 344/409 84%, Gaps = 15/409 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VD+    G + RAAVPSGASTG++EALELRDG  + +LGKGV+KAV +VN  I P L+
Sbjct  20   VEVDLYTEKGRF-RAAVPSGASTGVHEALELRDGDKTRFLGKGVTKAVDHVNKDIAPKLL 78
Query  66   GKDPT--DQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             K  +  DQ  ID +M++ LD T+N     K K+GANAIL V LAVCKAGA+    PL++
Sbjct  79   EKKLSVVDQEKIDKLMLE-LDATEN-----KSKFGANAILGVSLAVCKAGAAEKGVPLFR 132
Query  124  HIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNL 183
            HIA+LAG+ +++LPVPAFNVINGGSHAGNKLAMQEFMILP+GA++F+EAM++G EVYHNL
Sbjct  133  HIADLAGHADVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNL 192
Query  184  KSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFY 243
            K VIK KYG+DATNVGDEGGFAPNI EN E LELLK+AI KAGY DK+VIGMDVAASEFY
Sbjct  193  KGVIKGKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYADKIVIGMDVAASEFY 252
Query  244  GEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTA 303
              +   YDL+FK  + D K  I+G+QL DLYKSF+  YP++SIEDPFDQDDWE++ K T+
Sbjct  253  --RSGKYDLDFKSPD-DPKRHITGDQLADLYKSFIKNYPVLSIEDPFDQDDWENWTKFTS 309
Query  304  ECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGV 363
                 +QIVGDDL VTNP R+++A+++K CN LLLKVNQIGSVTESI+A ++++  GWGV
Sbjct  310  SV--DIQIVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIQACKLAQKNGWGV 367
Query  364  MASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAN 423
            M SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQL+RIEE+LG +A +AG +
Sbjct  368  MVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEQLGDKAKFAGKD 427
Query  424  FRKP 427
            FR P
Sbjct  428  FRHP 431

Sequence Alignment: 7. Allergen Name: Sal s 2.0101 Sequence ID: B5DGQ7

 Score = 418.9 bits 1810,  Expect = 2e-118
 Identities = 286/409 69%, Positives = 341/409 83%, Gaps = 15/409 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VD+  + G + RAAVPSGASTG++EALELRDG  S YLGKG  KAV +VN  I   L+
Sbjct  20   VEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKSRYLGKGTVKAVDHVNKDIAAKLI 78
Query  66   GKDPT--DQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             K  +  DQ  ID+FM++ LDGT+N     K K+GANAIL V LAVCKAGA+    PLY+
Sbjct  79   EKKFSVVDQEKIDHFMLE-LDGTEN-----KSKFGANAILGVSLAVCKAGAAEKGVPLYR 132
Query  124  HIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNL 183
            HIA+LAG+K+++LP PAFNVINGGSHAGNKLAMQEFMILPIGAS+F EAM++G EVYHNL
Sbjct  133  HIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHEAMRIGAEVYHNL 192
Query  184  KSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFY 243
            K+VIK KYG+DATNVGDEGGFAPNI EN E LELLKTAI KAGY DK++IGMDVAASEFY
Sbjct  193  KNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKIIIGMDVAASEFY 252
Query  244  GEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTA 303
              K   YDL+FK  + D    I+G+QL DLYKSF+  YP+ SIEDPFDQDDW  + K TA
Sbjct  253  --KAGKYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDDWAAWTKFTA 309
Query  304  ECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGV 363
                 +Q+VGDDL VTNP R+++A+++K CN LLLKVNQIGSVTESI+A ++++  GWGV
Sbjct  310  AV--DIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLAQSNGWGV 367
Query  364  MASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAN 423
            M SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQL+RIEEELG++A +AG +
Sbjct  368  MVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAKAKFAGKD 427
Query  424  FRKP 427
            +R P
Sbjct  428  YRHP 431

Sequence Alignment: 8. Allergen Name: Gal d 9.0101 Sequence ID: P07322

 Score = 403.9 bits 1744,  Expect = 8e-114
 Identities = 274/409 66%, Positives = 330/409 80%, Gaps = 15/409 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSD-YLGKGVSKAVANVNTIIGPALV 65
            ++VD+  + G + RAAVPSGASTGI+EALE RDG    +LGKGV KAV ++N  IGPAL+
Sbjct  20   VEVDLHTAKGHF-RAAVPSGASTGIHEALEPRDGDKKRFLGKGVLKAVEHINKTIGPALI 78
Query  66   GKDPT--DQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             K  +  +Q  ID  M++ +DGT+N     K K+GANAIL V LAVCKAGA+    PLY+
Sbjct  79   EKKISVVEQEKIDKVMIE-MDGTEN-----KSKFGANAILGVSLAVCKAGAAEKGVPLYR 132
Query  124  HIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNL 183
            HIA+LAGN  L+LPVPAFNVINGGSHAGNKLAMQEFM+LP+GA+SF +AM++G EVYH+L
Sbjct  133  HIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASFHDAMRVGAEVYHSL 192
Query  184  KSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFY 243
            K VIK KYG+DATNVG EGGFAPNI +N E LELLK AIA+AGYTDKVVIGMDVAASEF 
Sbjct  193  KGVIKAKYGKDATNVGGEGGFAPNILDNHEALELLKAAIAQAGYTDKVVIGMDVAASEFC 252
Query  244  GEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTA 303
              +D  Y L+FK   +  K  I+GEQL ++Y+ F+ +YP+VSIEDPFDQDDWE + +   
Sbjct  253  --RDGRYHLDFKSPPHT-KRYITGEQLGEIYRGFIKDYPVVSIEDPFDQDDWEAWKRFVF 309
Query  304  ECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGV 363
                 +Q+VGDDL VTNP R+    ++  CN LLLKVNQIGSVTESI+A ++++  GWGV
Sbjct  310  HV--DIQVVGDDLTVTNPKRIAHGAEQHACNCLLLKVNQIGSVTESIQACKLAQSHGWGV 367
Query  364  MASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAN 423
            M SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQL+RIEE LG +A +AG  
Sbjct  368  MVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAKFAGRK 427
Query  424  FRKP 427
            FR P
Sbjct  428  FRNP 431

Sequence Alignment: 9. Allergen Name: Rho m 1.0101 Sequence ID: Q870B9

 Score = 370.8 bits 1599,  Expect = 7e-104
 Identities = 262/411 63%, Positives = 321/411 78%, Gaps = 14/411 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++V++T   GT+ R+ VPSGASTG++EALELRDG  S +LGKGV KAVANVN  I PAL+
Sbjct  20   VEVELTTEKGTF-RSIVPSGASTGVHEALELRDGDKSKWLGKGVLKAVANVNDTIAPALI 78
Query  66   --GKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
                D  DQ  ID F+++ LDGT N     K KLGANAIL V LA  KAGA+    PLYK
Sbjct  79   EANIDVADQAKIDEFLLK-LDGTPN-----KAKLGANAILGVSLAAAKAGAAQKDVPLYK 132
Query  124  HIANLAGNKN--LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYH 181
            HIA+++  K   +VLPVP  NV+NGGSHAG  LA QEFMI+P GA SF E +++G EVYH
Sbjct  133  HIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSFSEGLRIGSEVYH 192
Query  182  NLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASE 241
            +LKS+ KKKYGQ A NVGDEGG AP+I+  KE L+L+ +AI  AGYT +V I MDVA+SE
Sbjct  193  HLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTGQVDIAMDVASSE 252
Query  242  FYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKM 301
            FY  KD  YDL+FK  N+D  + I+G QL +LY+ +++EYPIVSIEDPF +DDWE ++  
Sbjct  253  FY--KDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFAEDDWEAWSHF 310
Query  302  TAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGW 361
             ++   + QIVGDDL VTNP R+KKAI+ K  +ALLLKVNQIG++TESI+A   S  AGW
Sbjct  311  FSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQAANDSYAAGW 370
Query  362  GVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAG 421
            GVM SHRSGETEDTFIADLSVG+ +GQ KTGAP RSERLAK NQ+LRIEEELG +A+YAG
Sbjct  371  GVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEEELGDKAIYAG 430
Query  422  ANFRK 426
             +F K
Sbjct  431  KDFHK 435

Sequence Alignment: 10. Allergen Name: Cla h 6 Sequence ID: P42040

 Score = 370.6 bits 1598,  Expect = 9e-104
 Identities = 258/415 62%, Positives = 313/415 75%, Gaps = 11/415 2%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VDI    G L RA VPSGASTG +EA ELRDG  S + GKGV+KAVANVN II PAL+
Sbjct  20   VEVDIVTETG-LHRAIVPSGASTGSHEACELRDGDKSKWAGKGVTKAVANVNEIIAPALI 78
Query  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             +  D  DQ  +D F+  +LDGT N     K K+GANAIL V +AV KA A+  + PLY 
Sbjct  79   KENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILGVSMAVAKAAAAEKRVPLYA 132
Query  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN 182
            HI++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P GA SF EAM+ G EVY+ 
Sbjct  133  HISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFTEAMRQGAEVYQK 192
Query  183  LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEF 242
            LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI +AGYT ++ I MDVA+SEF
Sbjct  193  LKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQIKIAMDVASSEF 252
Query  243  YGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 302
            Y   +K YDL+FK  ++D  + I+ EQL D YK + ++YPIVSIEDPF +DDWE ++   
Sbjct  253  YKADEKKYDLDFKNPDSDKSKWITYEQLADQYKQLAAKYPIVSIEDPFAEDDWEAWSYFY 312
Query  303  AECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWG 362
               G   QIVGDDL VTNP  +KKAI+ K CNALLLKVNQIG++TE+I A + S  AGWG
Sbjct  313  KTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAINAAKDSFAAGWG 372
Query  363  VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGA 422
            VM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK NQ+LRIEEELG +AVYAG 
Sbjct  373  VMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIEEELGDKAVYAGD 432
Query  423  NFRKPV 428
            NFR  +
Sbjct  433  NFRTAI 438

Sequence Alignment: 11. Allergen Name: Cla h 6 Sequence ID: CAA55070

 Score = 363.7 bits 1568,  Expect = 1e-101
 Identities = 254/415 61%, Positives = 310/415 74%, Gaps = 11/415 2%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VDI    G L RA VPS ASTG +EA ELRDG  S + GKGV+KAVANVN II PAL+
Sbjct  20   VEVDIVTETG-LHRAIVPSVASTGSHEACELRDGDKSKWAGKGVTKAVANVNEIIAPALI 78
Query  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             +  D  DQ  +D F+  +LDGT N     K K+GANAIL V +AV KA A+  + PLY 
Sbjct  79   KENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILGVSMAVAKAAAAEKRVPLYA 132
Query  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN 182
            HI++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P GA SF EAM+ G EVY+ 
Sbjct  133  HISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFTEAMRQGAEVYQK 192
Query  183  LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEF 242
            LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI +AGYT ++ I MDVA+SEF
Sbjct  193  LKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQIKIAMDVASSEF 252
Query  243  YGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 302
            Y   +K YDL+FK  ++D  + I+ EQL D Y  + ++YPIVSIEDPF +DDWE ++   
Sbjct  253  YKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPFAEDDWEAWSYFY 312
Query  303  AECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWG 362
               G   QIVGDDL VTNP  +KKAI+ K CNALLLKVNQIG++TE+I A + S  AGWG
Sbjct  313  KTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAINAAKDSFAAGWG 372
Query  363  VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGA 422
            VM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK NQ+LRIEEELG + +YAG 
Sbjct  373  VMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIEEELGDKRLYAGD 432
Query  423  NFRKPV 428
            NFR  +
Sbjct  433  NFRTAI 438

Sequence Alignment: 12. Allergen Name: Asp f 22.0101 Sequence ID: AAK49451

 Score = 362.6 bits 1563,  Expect = 2e-101
 Identities = 257/413 62%, Positives = 310/413 75%, Gaps = 13/413 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VD+    G L RA VPSGASTG +EA ELRDG  + + GKGV KAV NVN  IGPAL+
Sbjct  20   VEVDVATETG-LHRAIVPSGASTGQHEAHELRDGDKTQWGGKGVLKAVKNVNETIGPALI 78
Query  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             +  D  DQ+ +D F+  +LDGT N     K  LGANAIL V LAV KAGA+    PLY 
Sbjct  79   KENIDVKDQSKVDEFL-NKLDGTAN-----KSNLGANAILGVSLAVAKAGAAEKGVPLYA 132
Query  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN 182
            HI++LAG K   VLPVP  NV+NGGSHAG +LA QEFMI+P  A SF EA++ G EVY+ 
Sbjct  133  HISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQK 192
Query  183  LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEF 242
            LK++ KKKYGQ A NVGDEGG AP+IQ  +E L+L+  AI +AGYT K+ I MDVA+SEF
Sbjct  193  LKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASSEF 252
Query  243  YGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 302
            Y    K YDL+FK   +D  + ++ EQL DLYKS+ ++YPIVSIEDPF +DDWE ++   
Sbjct  253  YKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPFAEDDWEAWSYFY 312
Query  303  AECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWG 362
                   QIVGDDL VTNP R+KKAI+ K+CNALLLKVNQIG++TESI+A + S    WG
Sbjct  313  KT--SDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQIGTLTESIQAAKDSYADNWG 370
Query  363  VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGA 422
            VM SHRSGETED  IAD++VGL +GQIKTGAPCRSERLAK NQ+LRIEEELG   VYAG+
Sbjct  371  VMVSHRSGETEDVTIADIAVGLRSGQIKTGAPCRSERLAKLNQILRIEEELGENTVYAGS 430
Query  423  NFRKPV 428
             FR  V
Sbjct  431  KFRTAV 436

Sequence Alignment: 13. Allergen Name: Pen c 22.0101 Sequence ID: AAK51201

 Score = 358.0 bits 1543,  Expect = 5e-100
 Identities = 254/413 61%, Positives = 309/413 74%, Gaps = 13/413 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VD+    G L RA VPSGASTG +EA+ELRDG  + + GKGV KAV NVN  IGPAL+
Sbjct  20   VEVDVVTETG-LHRAIVPSGASTGQHEAVELRDGDKAKWGGKGVLKAVKNVNETIGPALI 78
Query  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             +  D  DQ  +D F+  +LDGT N     K  LGANAIL V LA+ KA A+    PLY 
Sbjct  79   KENIDVKDQAKVDEFL-NKLDGTAN-----KGNLGANAILGVSLAIAKAAAAEKGVPLYV 132
Query  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN 182
            HI++LAG K   VLPVP  NV+NGGSHAG +LA QEFMI+P  A SF E ++ G EVY+ 
Sbjct  133  HISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDTAESFSEGLRQGAEVYQK 192
Query  183  LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEF 242
            LK++ KKKYGQ A NVGDEGG AP+IQ  +E L+L+  AI +AGYT K+ I MDVA+SEF
Sbjct  193  LKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKISIAMDVASSEF 252
Query  243  YGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 302
            Y    K YDL+FK  ++D  + ++ EQL DLYKS+ ++YPIVSIEDPF +DDWE ++   
Sbjct  253  YKTDAKKYDLDFKNPDSDPTKWLTYEQLADLYKSLAAKYPIVSIEDPFAEDDWEAWSYFY 312
Query  303  AECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWG 362
                   QIVGDDL VTNP R+KKAI+ K+CNALLLKVNQIG++TESI+A + S    WG
Sbjct  313  KT--SDFQIVGDDLTVTNPLRIKKAIELKSCNALLLKVNQIGTLTESIQAAKDSYADNWG 370
Query  363  VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGA 422
            VM SHRSGETED  IAD++VGL +GQIKTGAP RSERLAK NQ+LRIEEELG  A+YAG 
Sbjct  371  VMVSHRSGETEDVTIADIAVGLRSGQIKTGAPARSERLAKLNQILRIEEELGENAIYAGK 430
Query  423  NFRKPV 428
            NFR  V
Sbjct  431  NFRTSV 436

Sequence Alignment: 14. Allergen Name: Alt a 5 Sequence ID: Q9HDT3

 Score = 356.9 bits 1538,  Expect = 1e-99
 Identities = 253/413 61%, Positives = 310/413 75%, Gaps = 13/413 3%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VDI    G L RA VPSGASTG +EA ELRDG  S + GKGV+KAVANVN  I PAL+
Sbjct  20   VEVDIVTETG-LHRAIVPSGASTGSHEACELRDGDKSKWGGKGVTKAVANVNDTIAPALI 78
Query  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             +  D  DQ+ +D F+  +LDGT N     K  LGANAIL V +A+ KA A+    PLY 
Sbjct  79   KEKLDVKDQSAVDAFL-NKLDGTTN-----KTNLGANAILGVSMAIAKAAAAEKGVPLYA 132
Query  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN 182
            HI++LAG K   VLPVP  NV+NGGSHAG +LA QEFMI+P  A +F EAM+ G EVY+ 
Sbjct  133  HISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPCEAPTFSEAMRQGAEVYQK 192
Query  183  LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEF 242
            LK++ KK YGQ A NVGDEGG AP+IQ  +E L+L+  AI +AGYT K+ I MDVA+SEF
Sbjct  193  LKALAKKTYGQSAGNVGDEGGVAPDIQTAEEALDLITKAIEEAGYTGKIKIAMDVASSEF 252
Query  243  YGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 302
            Y   +K YDL+FK  ++D  + ++ EQL ++YKS+  +YPIVSIEDPF +DDWE ++   
Sbjct  253  YKADEKKYDLDFKNPDSDKSKWLTYEQLAEMYKSLAEKYPIVSIEDPFAEDDWEAWSYFF 312
Query  303  AECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWG 362
                   QIVGDDL VTNP  +KKAI+ K+CNALLLKVNQIG++TE+I+A + +  AGWG
Sbjct  313  KT--YDGQIVGDDLTVTNPEFIKKAIELKSCNALLLKVNQIGTITEAIQAAKDAFGAGWG 370
Query  363  VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGA 422
            VM SHRSGETED  IAD+ VGL +GQIKTGAP RSERLAK NQ+LRIEEELG  AVYAG 
Sbjct  371  VMVSHRSGETEDVTIADIVVGLRSGQIKTGAPARSERLAKLNQILRIEEELGDNAVYAGN 430
Query  423  NFRKPV 428
            NFR  V
Sbjct  431  NFRTAV 436

Sequence Alignment: 15. Allergen Name: Cur l 2.0101 Sequence ID: AAK67491

 Score = 330.2 bits 1421,  Expect = 1e-91
 Identities = 237/414 57%, Positives = 307/414 74%, Gaps = 17/414 4%
Query  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
            ++VDI    G L RA VPSGASTG +EA ELRDG  + + GKGV+KAVANVN II PAL+
Sbjct  20   VEVDIVTETG-LHRAIVPSGASTGSHEACELRDGDKTKWGGKGVTKAVANVNDIIAPALI 78
Query  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
             +  D  DQ+ +D F+  +LDGT+N     K KLGANAIL V +A+ KA A+    PLY 
Sbjct  79   KEKLDVKDQSAVDAFL-NKLDGTEN-----KTKLGANAILGVSMAIAKAAAAEKGVPLYA 132
Query  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKM--GVEVY 180
            HI++LAG K   V+   + NV+NGGSHAG  L  QEFMI P  A +F EA+++  G EVY
Sbjct  133  HISDLAGTKKPYVFRFLSKNVLNGGSHAGGFLLFQEFMIAP--AKTFAEALRIRQGAEVY 190
Query  181  HNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAAS 240
            + LK++ KK YGQ A N GDEGG AP+IQ  +E L+L+  AI  AG+T ++ I MDVA+S
Sbjct  191  QKLKALTKKTYGQSAGNYGDEGGVAPDIQTAEEALDLIVDAIEAAGHTGQIKIAMDVASS 250
Query  241  EFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAK 300
            EF+ + +K YDL+FK  ++D  + ++  QL ++YKS+  +YPIVSIEDPF +DDWE ++ 
Sbjct  251  EFFKDDEKKYDLDFKNPDSDKSKWLTYPQLAEMYKSLAEKYPIVSIEDPFAEDDWEAWSH 310
Query  301  MTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAG 360
               + G+  QIVGDDL VTNP  +K AI+ K+CNALLLKVNQIG+++E+I A + +  AG
Sbjct  311  FYKD-GD-FQIVGDDLTVTNPEFIKTAIELKSCNALLLKVNQIGTISEAINAAKDAFGAG 368
Query  361  WGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYA 420
            WGVM SHRSGETED  IAD+ VGL +GQIKT AP RSERLAKYNQ+LRIEEELG + ++A
Sbjct  369  WGVMVSHRSGETEDVTIADIVVGLRSGQIKTNAPARSERLAKYNQILRIEEELGDKRLFA 428
Query  421  GANFRKPVEPY 431
            G  F   +  Y
Sbjct  429  GNKFHTAINLY 439

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.