The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLIKSIIALVCLAVLAQADFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVSGPVPEPL
SNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTF
EKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLG
YSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYL
SVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPIMNG
EYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNGPLW
ILGDVFIGKYYTEFDMGNDRVGFATAV
Sequence Info Allergen Name Length Opt Bits Score E Value
Q03168 Aed a 11.0101 387 2571 592.4 1.1e-170
I1CLC6 Rhi o 1.0101 401 1219 284.2 6.9e-78
P54958 Bla g 2 352 543 130.2 1.4e-31
E7BQV5 Per a 2.0101 351 498 119.9 1.7e-28
CAA59419 Asp f 10 395 467 112.8 2.7e-26
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Aed a 11.0101 Sequence ID: Q03168

 Score = 592.4 bits 2571,  Expect = 1e-170
 Identities = 387/387 100%, Positives = 387/387 100%, Gaps = 0/387 0%
Query  1    MLIKSIIALVCLAVLAQADFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVSGPVPEPL 60
            MLIKSIIALVCLAVLAQADFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVSGPVPEPL
Sbjct  1    MLIKSIIALVCLAVLAQADFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVSGPVPEPL 60
Query  61   SNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTF 120
            SNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTF
Sbjct  61   SNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTF 120
Query  121  EKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLG 180
            EKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLG
Sbjct  121  EKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLG 180
Query  181  YSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYL 240
            YSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYL
Sbjct  181  YSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYL 240
Query  241  SVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPIMNG 300
            SVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPIMNG
Sbjct  241  SVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPIMNG 300
Query  301  EYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNGPLW 360
            EYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNGPLW
Sbjct  301  EYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNGPLW 360
Query  361  ILGDVFIGKYYTEFDMGNDRVGFATAV 387
            ILGDVFIGKYYTEFDMGNDRVGFATAV
Sbjct  361  ILGDVFIGKYYTEFDMGNDRVGFATAV 387

Sequence Alignment: 2. Allergen Name: Rhi o 1.0101 Sequence ID: I1CLC6

 Score = 284.2 bits 1219,  Expect = 7e-78
 Identities = 175/320 54%, Positives = 230/320 71%, Gaps = 7/320 2%
Query  59   PLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSS 118
            PLSNYL+AQYYG I IGTPPQ F VVFDTGSSNLWVPS  C  T+IAC++H +Y++  S 
Sbjct  78   PLSNYLNAQYYGEIEIGTPPQPFTVVFDTGSSNLWVPSTHC--TSIACFLHKRYDSASSR 135
Query  119  TFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILG 178
            T+ +NGT F IQYG+GSL G++S DT+ +GG+ V  Q FAE+  EPGL F  AKFDGI+G
Sbjct  136  TYSENGTEFAIQYGTGSLEGFISQDTLSVGGIQVEDQGFAESTKEPGLTFAFAKFDGIFG 195
Query  179  LGYSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNR-DPSAAEGGEIIFGGSDSNKYTGDF 237
            LGY +ISV   +P FY+M N+ L+D P+FSF+LN  +     GGE+IFGG D + + GD 
Sbjct  196  LGYDTISVKHTIPPFYHMVNRDLVDEPLFSFWLNDANKDQDNGGELIFGGVDEDHFEGDI 255
Query  238  TYLSVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPI 297
             +  V RK YW+  M+++K GD     +   A  DTG+SL+  P +    INK +G    
Sbjct  256  HWSDVRRKGYWEITMENIKFGDDYVDIDPVGAAIDTGSSLLVAPTTVAALINKELGAEKN 315
Query  298  MNGEYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNG 357
              G+Y+VDC+ +P LP+  FV+ GK F LEG DYVL V   G+  C+SGFMG+DIP P G
Sbjct  316  WAGQYVVDCNKVPSLPEFCFVFNGKDFCLEGKDYVLEV--QGQ--CISGFMGMDIPEPAG 371
Query  358  PLWILGDVFIGKYYTEFDMGNDRVGFA 384
            PLWI+GDVF+ K+Y+ +D+GN+RVG+A
Sbjct  372  PLWIVGDVFLRKFYSVYDLGNNRVGLA 398

Sequence Alignment: 3. Allergen Name: Bla g 2 Sequence ID: P54958

 Score = 130.2 bits 543,  Expect = 1e-31
 Identities = 107/319 33%, Positives = 171/319 53%, Gaps = 19/319 5%
Query  55   PVPEPLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNA 114
            P+ + +  +++ QY G   IG   Q+F  VFD+ S N+ V S+EC      C    KY  
Sbjct  26   PLYKLVHVFINTQYAGITKIGN--QNFLTVFDSTSCNVVVASQECVGGACVCPNLQKYE- 82
Query  115  KKSSTFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQ--TFAEAINEPGLVFVAAK 172
            K    +  +G      + +GS  G    D++ +  ++ ++Q   +A+ +++   ++ A  
Sbjct  83   KLKPKYISDGNVQVKFFDTGSAVGRGIEDSLTISNLTTSQQDIVLADELSQEVCILSADV 142
Query  173  FDGILGLGYSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNK 232
              GI   G  + ++ G   V+ N   + LI APVFS +  R       GEIIFGGSD   
Sbjct  143  VVGIAAPGCPN-ALKGKT-VLENFVEENLI-APVFSIHHARFQDGEHFGEIIFGGSDWKY 199
Query  233  YTGDFTYLSVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAI 292
              G+FTY+ +     W+F++D VK+GDT     G +AI DT  ++I GP + V  IN+AI
Sbjct  200  VDGEFTYVPLVGDDSWKFRLDGVKIGDTTVAPAGTQAIIDTSKAIIVGPKAYVNPINEAI 259
Query  293  GGTPIMNGEYMV---DCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMG 349
            G          +   DCS IP LP ++FV+ G++F++    Y+    Q    +C SGF  
Sbjct  260  GCVVEKTTTRRICKLDCSKIPSLPDVTFVINGRNFNISSQYYI----QQNGNLCYSGFQ- 314
Query  350  IDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFATAV 387
               P  +   + +GD F+  YY+EF+  N  +GF  +V
Sbjct  315  ---PCGHSDHFFIGDFFVDHYYSEFNWENKTMGFGRSV 349

Sequence Alignment: 4. Allergen Name: Per a 2.0101 Sequence ID: E7BQV5

 Score = 119.9 bits 498,  Expect = 2e-28
 Identities = 102/312 32%, Positives = 158/312 50%, Gaps = 22/312 7%
Query  59   PLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSS 118
            P+  Y++ QY G + +G   Q F  VFDT S    +PS  C      C   +KY + K  
Sbjct  32   PVEEYINTQYVGPVQLGN--QYFLCVFDTSSYTTVIPSASCVSGGCNCANVHKYYSNKPV 89
Query  119  TFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILG 178
            +   N  +  I  GSG  +G  + D + +  ++ T Q F  A ++      +   D ++G
Sbjct  90   S--NNVASVRI-LGSGYANGSEAHDYIAVSTLNATNQGFLLA-DDISNDICSLGADCVIG 145
Query  179  LGY--SSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGD 236
            LG   S  +   +  V  N  NQ  I A  FSF+  R P     G +++GG+    Y GD
Sbjct  146  LGRPKSGRAAFNLPTVMENFVNQDNI-ANSFSFHHGRYPDGQHRGVLVLGGTIPAYYRGD 204
Query  237  FTYLSVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTP 296
            FTY+ +  K  W FK+DS+ VG+ E       A  D+   +I GP  E+  IN  +G T 
Sbjct  205  FTYVPLVDKDTWNFKVDSISVGN-EVVATDQLAFVDSSKYVITGPAEEIKKINDRLGCTN 263
Query  297  IMNGEYMV---DCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIP 353
             + G   +   DC  +  +P ++F +GG +F++    ++    Q    +C SGF      
Sbjct  264  KVIGSRTLCVFDCDKLDNVPSVTFTIGGVAFNISSTYHI----QQNGDLCYSGFQY---- 315
Query  354  PPNGPLWILGDVFIGKYYTEFDMGNDRVGFATAV 387
               G  + +GD F+  YY +FD  N R+GFA +V
Sbjct  316  -SAGKCFHFGDFFMDNYYAKFDGQNKRMGFAKSV 348

Sequence Alignment: 5. Allergen Name: Asp f 10 Sequence ID: CAA59419

 Score = 112.8 bits 467,  Expect = 3e-26
 Identities = 115/318 36%, Positives = 167/318 52%, Gaps = 29/318 9%
Query  47   LKYNAVSGPVPEPLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIAC 106
            +K  A SG        Y D++Y   + +G    ++ + FDTGS++LWV S E S +  + 
Sbjct  66   VKAAASSGSAVTTPEQY-DSEYLTPVKVGGT--TLNLDFDTGSADLWVFSSELSASQSSG 122
Query  107  LMHNKYNAKKSSTFEK-NGTAFHIQYGSGS-LSGYLSTDTVGLGGVSVTKQTFAEAINEP 164
              H  Y  K S+  +K NG  + IQYG GS  SG +  DTV +GGV+   Q   EA +  
Sbjct  123  --HAIY--KPSANAQKLNGYTWKIQYGDGSSASGDVYKDTVTVGGVTAQSQA-VEAASHI 177
Query  165  GLVFVAAK-FDGILGLGYSSISVDGVVP--VFYNMFNQGLIDAPVFSFYLNRDPSAAEGG 221
               FV  K  DG+LGL +SSI+     P   F++     L D+P+F+  L         G
Sbjct  178  SSQFVQDKDNDGLLGLAFSSINTVSPRPQTTFFDTVKSQL-DSPLFAVTLKYHAP----G 232
Query  222  EIIFGGSDSNKYTGDFTYLSVDR-KAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAG 280
               FG  D++K+ G++TY  VD  + +W F  D   VG+    +N    IADTGT+L+  
Sbjct  233  TYDFGYIDNSKFQGELTYTDVDSSQGFWMFTADGYGVGNGAPNSNSISGIADTGTTLLLL 292
Query  281  PVSEVTAINKAIGGTPIMN--GEYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQM 338
              S V    + + G    N  G Y+  CS   KLP  + V+GG +  + G          
Sbjct  293  DDSVVADYYRQVSGAKNSNQYGGYVFPCS--TKLPSFTTVIGGYNAVVPGEYINYAPVTD 350
Query  339  GKTICLSGFMGIDIPPPNG-PLWILGDVFIGKYYTEFDMGNDRVGFA 384
            G + C  G     I   +G  + I+GD+F+   Y  FD    R+GFA
Sbjct  351  GSSTCYGG-----IQSNSGLGFSIFGDIFLKSQYVVFDSQGPRLGFA 392

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.