The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQA
KDSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLI
VDRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEV
LYDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEP
GTNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLA
KMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKL
KQDILNLRTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD
VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL
KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT
PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS
KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT
VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM
AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID
EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL
SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDKLPTL
ISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPDF
AFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQW
KIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFR
LNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTSFD
SKVMTRPDTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVRVHVP
GESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLSYDEK
MDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKRGNKI
LRTCQKAVVLSMLLDEVDISMEVPSDALIALYSQGLFSLSEIDNLDVSLDVSNPKNAGKK
KIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDLLINNVFYED
ETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRE
NEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMG
DRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKP
EHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYH
HNVNKHCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLK
KRIEKGANPDLSQKPVSTTEELTVPFVCKA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q868N5 Api m 12.0101 1770 11613 2653.0 0
G8IIT0 Ves v 6.0101 1756 3174 729.4 1.4e-210
P87498 gal d 6.0101 1912 146 39.2 0.0089
P87498 Gal d 6.0101 1912 146
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Api m 12.0101 Sequence ID: Q868N5

 Score = 2653.0 bits 11613,  Expect = 0
 Identities = 1770/1770 100%, Positives = 1770/1770 100%, Gaps = 0/1770 0%
Query  1    MLLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQA 60
            MLLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQA
Sbjct  1    MLLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQA 60
Query  61   KDSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLI 120
            KDSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLI
Sbjct  61   KDSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLI 120
Query  121  VDRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEV 180
            VDRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEV
Sbjct  121  VDRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEV 180
Query  181  LYDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEP 240
            LYDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEP
Sbjct  181  LYDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEP 240
Query  241  GTNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLA 300
            GTNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLA
Sbjct  241  GTNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLA 300
Query  301  KMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKL 360
            KMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKL
Sbjct  301  KMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKL 360
Query  361  KQDILNLRTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD 420
            KQDILNLRTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD
Sbjct  361  KQDILNLRTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD 420
Query  421  VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL 480
            VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL
Sbjct  421  VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL 480
Query  481  KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT 540
            KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT
Sbjct  481  KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT 540
Query  541  PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS 600
            PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS
Sbjct  541  PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS 600
Query  601  KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT 660
            KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT
Sbjct  601  KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT 660
Query  661  VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM 720
            VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM
Sbjct  661  VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM 720
Query  721  AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID 780
            AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID
Sbjct  721  AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID 780
Query  781  EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL 840
            EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL
Sbjct  781  EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL 840
Query  841  SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDKLPTL 900
            SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDKLPTL
Sbjct  841  SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDKLPTL 900
Query  901  ISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPDF 960
            ISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPDF
Sbjct  901  ISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPDF 960
Query  961  AFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQW 1020
            AFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQW
Sbjct  961  AFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQW 1020
Query  1021 KIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFR 1080
            KIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFR
Sbjct  1021 KIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFR 1080
Query  1081 LNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTSFD 1140
            LNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTSFD
Sbjct  1081 LNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTSFD 1140
Query  1141 SKVMTRPDTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVRVHVP 1200
            SKVMTRPDTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVRVHVP
Sbjct  1141 SKVMTRPDTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVRVHVP 1200
Query  1201 GESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLSYDEK 1260
            GESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLSYDEK
Sbjct  1201 GESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLSYDEK 1260
Query  1261 MDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKRGNKI 1320
            MDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKRGNKI
Sbjct  1261 MDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKRGNKI 1320
Query  1321 LRTCQKAVVLSMLLDEVDISMEVPSDALIALYSQGLFSLSEIDNLDVSLDVSNPKNAGKK 1380
            LRTCQKAVVLSMLLDEVDISMEVPSDALIALYSQGLFSLSEIDNLDVSLDVSNPKNAGKK
Sbjct  1321 LRTCQKAVVLSMLLDEVDISMEVPSDALIALYSQGLFSLSEIDNLDVSLDVSNPKNAGKK 1380
Query  1381 KIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDLLINNVFYED 1440
            KIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDLLINNVFYED
Sbjct  1381 KIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDLLINNVFYED 1440
Query  1441 ETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRE 1500
            ETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRE
Sbjct  1441 ETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRE 1500
Query  1501 NEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMG 1560
            NEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMG
Sbjct  1501 NEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMG 1560
Query  1561 DRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKP 1620
            DRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKP
Sbjct  1561 DRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKP 1620
Query  1621 EHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYH 1680
            EHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYH
Sbjct  1621 EHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYH 1680
Query  1681 HNVNKHCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLK 1740
            HNVNKHCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLK
Sbjct  1681 HNVNKHCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLK 1740
Query  1741 KRIEKGANPDLSQKPVSTTEELTVPFVCKA 1770
            KRIEKGANPDLSQKPVSTTEELTVPFVCKA
Sbjct  1741 KRIEKGANPDLSQKPVSTTEELTVPFVCKA 1770

Sequence Alignment: 2. Allergen Name: Ves v 6.0101 Sequence ID: G8IIT0

 Score = 729.4 bits 3174,  Expect = 1e-210
 Identities = 712/1740 40%, Positives = 1121/1740 64%, Gaps = 40/1740 2%
Query  2    LLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQAK 61
            ++LL L +    +  + +H W+VG EY YLVRSRTLT L  LSD + GIL+KA L +Q  
Sbjct  5    FILLLLGVAVSNLDNNIEHGWKVGEEYQYLVRSRTLTGLQTLSDQYAGILMKATLRIQCN 64
Query  62   DSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLIV 121
              + L A++   QYA++++ +PDGW++ ISDQMLE + LP+S +PF I++KHG+IRDLIV
Sbjct  65   SPDTLRAQLLKPQYAQIHKKLPDGWDSRISDQMLEHKHLPLSNEPFVIKLKHGVIRDLIV 124
Query  122  DRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEVL 181
             ++VPTWEVNI+KSI+ Q+Q DTQGEN     + Q+P DD P+A+F+ MED V GKCEVL
Sbjct  125  SKNVPTWEVNIIKSIISQFQADTQGENLKGNKNTQIPEDDNPFATFRVMEDCVSGKCEVL 184
Query  182  YDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEPG 241
            YD+ PL++ V++  P ++P P L+G+G H+ + K +N+D C+QR++Y+FG++ N+  E  
Sbjct  185  YDVVPLTEDVLQHRPHILPKPELRGNGEHIYITKTRNYDKCEQRMDYYFGISGNANWESD 244
Query  242  TNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLAK 301
               N K   +SSTS +VIS +LK+F IQ++VTT+++++ PRL D Q  +V+S+MN+TL  
Sbjct  245  IRNNDKIMKKSSTSNMVISGNLKNFVIQTAVTTTEIIMKPRLVDDQESIVISKMNVTLVS 304
Query  302  MEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKLK 361
            + K S P+P  +NPESTGNLVY YN+PFS   +RR+ + +++ N +   N L SS +   
Sbjct  305  VNKVSSPIPAPNNPESTGNLVYTYNDPFSKTVQRRLGRPSVSPNSM--SNELDSSADS-D 361
Query  362  QDILNLRTDISSSSS-SISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD 420
            +D+  +R     S   ++ S E+  F Q KPTL +AP+N +LP F+G  GK +  S K++
Sbjct  362  EDLRLMREKYGKSDKMNVVSDEDKAFRQMKPTLHEAPKNPMLPLFIGNNGKAVVMSDKIN 421
Query  421  VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL 480
                   L+ +IA+E+ED + +P   TLEKF I+  L+ +M+ +QI++ E +++   NE+
Sbjct  422  SGKMVMTLVQEIASEMEDPNVMPDRETLEKFTIVSRLISSMSLEQINKAEGSLHSVWNEI 481
Query  481  KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT 540
              ++ +++ K+N   VFRDAI   GTGPA++TIK WIE+   +  EAA++++ +PKT RT
Sbjct  482  GSDETNRMKKENARAVFRDAIANAGTGPALMTIKRWIEKKEIEGCEAADVLASIPKTART 541
Query  541  PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS 600
            PT  Y+ +FF L  NP+V  +  LN++A LSF E++H AQV+  SI+N+YPV+ FGRL+S
Sbjct  542  PTAEYVDAFFSLASNPEVQKQTCLNSSAVLSFAELVHRAQVSNSSIYNHYPVNVFGRLSS 601
Query  601  KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT 660
            + ++++  +YIPF+  EL+KA ++ DSPRIQ YI+ALG+ G PKIL+V+EPYLEGK++++
Sbjct  602  RRNDAVLRKYIPFFAEELKKAIKDGDSPRIQVYILALGLTGHPKILNVLEPYLEGKERVS 661
Query  661  VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM 720
             +QR LMV SL KL E  P LARSVLYKIYLNT + H++RC AV L+M+TNPPL ML RM
Sbjct  662  TYQRFLMVMSLRKLCEVKPSLARSVLYKIYLNTWDVHQIRCAAVNLIMRTNPPLDMLTRM 721
Query  721  AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID 780
            A+FT  D + QVNSAVKS I+S   L  PEW++L + AR V HL+      Y  S  +  
Sbjct  722  AQFTNTDFSGQVNSAVKSAIESAANLNYPEWEELTRNARKVLHLMNTESDKYYYSESHFT 781
Query  781  EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL 840
            E + EN  +   M+LNY+GS D+VIP   ++    S      P  ++   ISSVKS++E+
Sbjct  782  E-MEENDQLSYRMMLNYIGSVDNVIPLSTHFALQPSYNGFLSPVYELDMSISSVKSLLEM 840
Query  841  SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDK-LPT 899
                 +  +T  S AEK A+ L I  + +  +EGN+     Y  ++F FD H +++ L  
Sbjct  841  YWHKSEKGDTEESFAEKTAKMLHIESDNVEQVEGNVFFKTPYLNRYFSFDNHTIERILHD 900
Query  900  LISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPD 959
            ++S      +    +N+N L +Y+   SFPTETGLPFVY+++V  + K S   +  +   
Sbjct  901  MVSP-----RHSHHVNMNKLLSYDITLSFPTETGLPFVYSLHVPTIKKFSVISKPDMKSK 955
Query  960  FAFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQ 1019
            F      ++RL  S   QGRVGF+TPF+H+ F+SGID+N++V+ P K+ + +N  K  + 
Sbjct  956  F------DVRLLTSTKHQGRVGFITPFDHQAFLSGIDNNMQVFLPCKLDFHLNNEKSRLD 1009
Query  1020 WKIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGP- 1078
              + P+K   K+RL H+SV+P+ S ++I++LRPL +EK T  +     T + +P+N    
Sbjct  1010 AALQPLKHNSKTRLGHFSVIPYTSQYEIMSLRPLLLEKNTHRIQEKKTTHIRIPQNPNSI 1069
Query  1079 FRLNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTS 1138
            F + VE     E++ + + +E   + +  P ++    Y K+D+++  + ++ + V F+ +
Sbjct  1070 FSVEVEADNLAEKIQQWLRSENKWEDMLSPSSLALGTYEKIDLFVKPDLQENEAVKFTAT 1129
Query  1139 FDSKVMTRP--DTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVR 1196
            +D+K +     DT+ E+W      ++   +  +S  RR+E ++E  +GI S K+YV+D  
Sbjct  1130 LDTKEIRSNNLDTNDESWKSGNKVLKTMHQALDSPARRKEFLQEVVKGINSGKAYVIDAG 1189
Query  1197 VHVPGESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLS 1256
            + VPG  +S    TL  + SN E+K R + +W   +P  +  Y++C+  Q   SP T + 
Sbjct  1190 LEVPGLWKSNHACTLCLASSNDENKFRSIFYWYTNIPSQDITYQMCVNGQTRSSPTTPFD 1249
Query  1257 YDEKMDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKR 1316
            Y + +D  P  +F+++I+ G+ C     + + G+++QS   K  V  + I+K C E+++ 
Sbjct  1250 YKKILDSNPTNEFSINIQSGRTCTDNSLVTIKGQIKQSEDYKTYVQESRIVKRCDENVR- 1308
Query  1317 GNKILRTCQKAVVLSMLLDEVDISMEV-----PSDALIALYSQGLFSLSEIDNLDVSLDV 1371
             N + + CQKA  ++  L+E+D+++        SD  +    +G   +    N+ V  ++
Sbjct  1309 -NSV-KDCQKAAEMAKNLNEIDMTITKHNSAEESDTELEKIFHGTKKMLTGLNVRVVSEI 1366
Query  1372 SNPKNAGKKKIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDL 1431
                +     I V+ KL+  +  A+ + +       F D+ + D G   +D ++  ++ +
Sbjct  1367 QEHSDVNDNDIRVQIKLSPNMTSAEGMASKSGQILTFSDIHI-DMGIDNDDEMNEIEKGI 1425
Query  1432 LINNVFYEDETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKD 1491
            L          +C L    A+TFDGK YPL+LG C H + TTYPR  P+  N+++ IP++
Sbjct  1426 LHG-------ATCTLRNNEAETFDGKVYPLKLGKCAHVLFTTYPRNAPNEPNKRMSIPEN 1478
Query  1492 KSVSVLSRENEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENE 1551
              V+V++ E E  +KE+++LLG+D+I F   + ++   +VNG+K+  S+ ++YQ ++ +E
Sbjct  1479 MKVTVIAEETENNKKELQILLGNDEILF-KSSGTEVSAWVNGQKVKCSQKESYQHIKNDE 1537
Query  1552 IIFEIYKMGDRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVG 1611
             +FEI+++    I L SDK+D+ LA D + V ++    Y+ SVRGLCG+FD  S NDFV 
Sbjct  1538 TLFEIFELPGPAIKLISDKYDIKLAYDTDHVQIEVPHTYQQSVRGLCGDFDGRSENDFVT 1597
Query  1612 PKNCLFRKPEHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLD 1671
            PKNC+++KPE F A+Y L   +CEG +LN AK  +   CIR+   +  +VISD E+GR  
Sbjct  1598 PKNCMLQKPEEFAATYIL-KERCEGPALNNAKKAERSKCIRKV-LRFSDVISDGEAGRPY 1655
Query  1672 TEMSTWGYHHNVNK-HCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCM 1730
                 WGYH   NK +C  +RTQ+   DD ICFT+RPV +C+SGC +V TK K Y+++C+
Sbjct  1656 VNWKQWGYHKKENKKQCNTYRTQIITKDDNICFTIRPVPTCSSGCKSVVTKLKEYQLYCL 1715
Query  1731 EKNEAAMKLKKRIEKGANPDLSQKPVSTTEELTVPFVCKA 1770
             KN++++ +KKRIE+GANPDLSQ+  +    ++VP+ C A
Sbjct  1716 PKNDSSLGMKKRIEQGANPDLSQRTPTDNAMISVPLECVA 1755

Sequence Alignment: 3. Allergen Name: gal d 6.0101 Sequence ID: P87498

 Score = 39.2 bits 146,  Expect = 0.009
 Identities = 108/415 26%, Positives = 211/415 50%, Gaps = 57/415 13%
Query  636  ALGMIGEP---KILSVFEP-YLEGKQQMTVFQRTLMVGSLGKLTETNPKLARSVLYKIYL 691
            ALG +G P   K +  F P Y  G  ++ +      V +L  +   +P++ +++  +I+L
Sbjct  483  ALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPQMVQAITLEIFL 542
Query  692  NTMESHEVRCTAVFLLMKTNPPLSMLQRMAEFTKLDTNRQVNSAVKSTIQSLMKLKSPEW 751
            N      +R  A  +L++T P L +L  + +    + + QV S + S +++L +  +P+ 
Sbjct  543  NHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKEPSMQVASFIYSHLRALGRSTAPDL 602
Query  752  KDLAKKARSVNHLLTHHEYD---YELSRGY---IDEKILENQNIITHMILNYVGSEDSVI 805
            + +A   R     L+  ++D   Y++S+ +   + ++ L +     + +LN  G   S+I
Sbjct  603  QMMASACRMAVRALSP-KFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAG---SLI 658
Query  806  PRILYLTWYSSN--GDIKVPSTKVLAMISSVKSFMELSLRSV---KDRETIISAAE--KI 858
            P  + ++   ++  G +  P    +A     + + E+ +R     KD ET     E  K 
Sbjct  659  PT-MAVSQLRTHFLGRVADPIEVGIA----AEGLQEMFVRGYSPDKDWETNYDFREILKK 713
Query  859  AEELKIVPEELVPLEGNLMINNKYALKFFPFDKHIL-----------DKLPTLISNYIEA 907
              + K +P +  P+    +      L F  +DK  L           +K+P+ I   I +
Sbjct  714  LSDWKALPRDK-PFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPS-IRRLISS 771
Query  908  VKEG---KFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINP----DF 960
            ++ G   ++    +L     +   PT  G+P   +F    +TK +G VQAQI P    DF
Sbjct  772  LQTGIGRQWTKALLLSEIRCI--VPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDF 829
Query  961  AF--IVNSNLRLT--FSKNVQGRVGFVTPFEHRHFISGIDSNLHVYA--PLKISLDVNTP 1014
             +  ++NSN+RL    S ++   + FV         +G++++  V A  P+ +   +   
Sbjct  830  RLTELLNSNVRLRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMK 889
Query  1015 KGNMQWKIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRP-MIPD 1065
            + +++ +I P K  E++ L   S   F    +I +L    M     P  +PD
Sbjct  890  EKSIKAEIPPCK--EETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVPD 939

Sequence Alignment: 4. Allergen Name: Gal Sequence ID: P87498

 Score = 39.2 bits 146,  Expect = 0.009
 Identities = 108/415 26%, Positives = 211/415 50%, Gaps = 57/415 13%
Query  636  ALGMIGEP---KILSVFEP-YLEGKQQMTVFQRTLMVGSLGKLTETNPKLARSVLYKIYL 691
            ALG +G P   K +  F P Y  G  ++ +      V +L  +   +P++ +++  +I+L
Sbjct  483  ALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPQMVQAITLEIFL 542
Query  692  NTMESHEVRCTAVFLLMKTNPPLSMLQRMAEFTKLDTNRQVNSAVKSTIQSLMKLKSPEW 751
            N      +R  A  +L++T P L +L  + +    + + QV S + S +++L +  +P+ 
Sbjct  543  NHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKEPSMQVASFIYSHLRALGRSTAPDL 602
Query  752  KDLAKKARSVNHLLTHHEYD---YELSRGY---IDEKILENQNIITHMILNYVGSEDSVI 805
            + +A   R     L+  ++D   Y++S+ +   + ++ L +     + +LN  G   S+I
Sbjct  603  QMMASACRMAVRALSP-KFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAG---SLI 658
Query  806  PRILYLTWYSSN--GDIKVPSTKVLAMISSVKSFMELSLRSV---KDRETIISAAE--KI 858
            P  + ++   ++  G +  P    +A     + + E+ +R     KD ET     E  K 
Sbjct  659  PT-MAVSQLRTHFLGRVADPIEVGIA----AEGLQEMFVRGYSPDKDWETNYDFREILKK 713
Query  859  AEELKIVPEELVPLEGNLMINNKYALKFFPFDKHIL-----------DKLPTLISNYIEA 907
              + K +P +  P+    +      L F  +DK  L           +K+P+ I   I +
Sbjct  714  LSDWKALPRDK-PFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPS-IRRLISS 771
Query  908  VKEG---KFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINP----DF 960
            ++ G   ++    +L     +   PT  G+P   +F    +TK +G VQAQI P    DF
Sbjct  772  LQTGIGRQWTKALLLSEIRCI--VPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDF 829
Query  961  AF--IVNSNLRLT--FSKNVQGRVGFVTPFEHRHFISGIDSNLHVYA--PLKISLDVNTP 1014
             +  ++NSN+RL    S ++   + FV         +G++++  V A  P+ +   +   
Sbjct  830  RLTELLNSNVRLRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMK 889
Query  1015 KGNMQWKIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRP-MIPD 1065
            + +++ +I P K  E++ L   S   F    +I +L    M     P  +PD
Sbjct  890  EKSIKAEIPPCK--EETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVPD 939

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.