The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLPKFFFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGP
YGYGGVQVSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVD
IVLNHMTGGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEAR
NCRLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN
NEFFTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNF
GTEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMS
SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL
IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII
SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES
Sequence Info Allergen Name Length Opt Bits Score E Value
AHX03180 Der f 4.0101 525 3706 851.0 0
AAD38943 Eur m 4.0101 521 3246 746.1 1.1e-216
AAD38942 Der p 4 496 3180 731.1 3.5e-212
AAQ24543 Blo t 4.0101 506 2408 555.1 3.3e-159
Q2L7A6 Bla g 11.0101 515 1263 294.1 1.3e-80
AKH04310 Per a 11.0101 494 416 101.1 1.6e-22
P13080 Aed a 4.0101 579 182 47.7 2.2e-06
P49274 Der p 4 19 100 32.9 0.002
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 4.0101 Sequence ID: AHX03180

 Score = 851.0 bits 3706,  Expect = 0
 Identities = 525/525 100%, Positives = 525/525 100%, Gaps = 0/525 0%
Query  1    MLPKFFFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGP 60
            MLPKFFFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGP
Sbjct  1    MLPKFFFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGP 60
Query  61   YGYGGVQVSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVD 120
            YGYGGVQVSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVD
Sbjct  61   YGYGGVQVSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVD 120
Query  121  IVLNHMTGGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEAR 180
            IVLNHMTGGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEAR
Sbjct  121  IVLNHMTGGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEAR 180
Query  181  NCRLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN 240
            NCRLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN
Sbjct  181  NCRLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN 240
Query  241  NEFFTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNF 300
            NEFFTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNF
Sbjct  241  NEFFTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNF 300
Query  301  GTEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMS 360
            GTEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMS
Sbjct  301  GTEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMS 360
Query  361  SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL 420
            SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL
Sbjct  361  SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL 420
Query  421  IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII 480
            IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII
Sbjct  421  IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII 480
Query  481  SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES 525
            SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES
Sbjct  481  SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES 525

Sequence Alignment: 2. Allergen Name: Eur m 4.0101 Sequence ID: AAD38943

 Score = 746.1 bits 3246,  Expect = 1e-216
 Identities = 456/519 87%, Positives = 491/519 94%, Gaps = 7/519 1%
Query  1    MLPKFFFILITVLTLLVSLFVNGD--SKFSNPHFIGNRSVITHLMEWKYDDIGDECERFL 58
            MLPK ++ LITV  L++SLFV  +   K+ NPHFIGNR VITHLMEWKYDDIGDECERFL
Sbjct  1    MLPKIYLKLITV--LFISLFVQNNVHCKYHNPHFIGNRCVITHLMEWKYDDIGDECERFL 58
Query  59   GPYGYGGVQVSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIY 118
            GPYGYGGVQVSPVNEHAI+D RPWYERYQPVSYD+ TRSGDEQQFRRMV+RCNKAGVRIY
Sbjct  59   GPYGYGGVQVSPVNEHAILDRRPWYERYQPVSYDLRTRSGDEQQFRRMVKRCNKAGVRIY 118
Query  119  VDIVLNHMTGGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIE 178
            VDIVLNHMTGGQSG GTNG+HY+G+ MQYPGVPFGPNDFHGHE+C T DLEIHNYS+R E
Sbjct  119  VDIVLNHMTGGQSGQGTNGNHYNGITMQYPGVPFGPNDFHGHESCQTKDLEIHNYSDRNE 178
Query  179  ARNCRLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHN 238
            ARNCRL GLRDLKQQSEYV++KQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYS+LH 
Sbjct  179  ARNCRLSGLRDLKQQSEYVRKKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSQLHT 238
Query  239  LNNEFFTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLR 298
            LN EFF ENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFR NNQLRWL+
Sbjct  239  LNKEFFPENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRGNNQLRWLK 298
Query  299  NFGTEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRV 358
            NFGTEWGLVPS DALVMIDSHDLRVGHTG+LGFNINCFEARLLKA+TAFMLAWNYGIPRV
Sbjct  299  NFGTEWGLVPSNDALVMIDSHDLRVGHTGKLGFNINCFEARLLKASTAFMLAWNYGIPRV 358
Query  359  MSSYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKF 418
            MSSYFW+QIIRDGKDVNDWVGPPTDQHGNILSVHPN D+TCNHEWICEHRWR+IYNMV+F
Sbjct  359  MSSYFWNQIIRDGKDVNDWVGPPTDQHGNILSVHPNADLTCNHEWICEHRWRQIYNMVRF 418
Query  419  KLIAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCD 478
            K+IAGQEPV NWWDNGD QIAFSRG+ AFIAINLQKNG   DKNL++RL+TGLP G YCD
Sbjct  419  KMIAGQEPVRNWWDNGDYQIAFSRGSHAFIAINLQKNG---DKNLRQRLHTGLPAGTYCD 475
Query  479  IISGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVE 524
            IISG+LI+N+C GKSIQVDKNGL+DIYVGHDE+DAFVAYHI AR+E
Sbjct  476  IISGDLIHNKCTGKSIQVDKNGLADIYVGHDELDAFVAYHIGARIE 521

Sequence Alignment: 3. Allergen Name: Der p 4 Sequence ID: AAD38942

 Score = 731.1 bits 3180,  Expect = 3e-212
 Identities = 441/496 88%, Positives = 471/496 94%, Gaps = 4/496 0%
Query  26   KFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAIMDGRPWYER 85
            K+ NPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAI+D RPWYER
Sbjct  1    KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER 60
Query  86   YQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVLNHMTGGQSGLGTNGHHYDGVAM 145
            YQPVSYDI TRSGDEQQFRRMV+RCNKAGVRIYVDIVLNHMTG QSG GTNGHHYDG  +
Sbjct  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL 120
Query  146  QYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNCRLVGLRDLKQQSEYVKQKQVDFL 205
            QYPGVPFGPNDFHGHE+CPT DLEIH+Y+N  EARNCRL GLRDLKQQSEYV+QKQVDFL
Sbjct  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
Query  206  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNEFFTENSHPFIYHETIYYGGNGIN 265
            NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN EFF ENS+PFIYHETIYYGGNGIN
Sbjct  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN 240
Query  266  SNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFGTEWGLVPSGDALVMIDSHDLRVGH 325
            SNEYTSLGRIIEFRFYKEITNVFR NN L WL+NFGTEWGLVPSGDALVMIDSHDLRVGH
Sbjct  241  SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH 300
Query  326  TGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMSSYFWDQIIRDGKDVNDWVGPPTDQH 385
            TG+LGFNINCFE RLLKAATAFMLAWNYG+PRVMSSYFW+QII+DGKDVNDWVGPP+D++
Sbjct  301  TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN 360
Query  386  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKLIAGQEPVNNWWDNGDNQIAFSRGNR 445
            GNILSVHPNPDMTCNHEWICEHRWREIYNMVKF++IAGQEPV+NWWDNGD QIAFSRGNR
Sbjct  361  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR 420
Query  446  AFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDIISGNLINNRCMGKSIQVDKNGLSDIY 505
            AFIAINLQKN     +NLQ++L+TGLP G YCDIISGNLI+N+C GKSI+VDKNG +D+Y
Sbjct  421  AFIAINLQKN----QQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVY 476
Query  506  VGHDEFDAFVAYHIDARVES 525
            VGHDEFDAFVAYHI AR+ S
Sbjct  477  VGHDEFDAFVAYHIGARIVS 496

Sequence Alignment: 4. Allergen Name: Blo t 4.0101 Sequence ID: AAQ24543

 Score = 555.1 bits 2408,  Expect = 3e-159
 Identities = 329/500 65%, Positives = 405/500 81%, Gaps = 5/500 1%
Query  8    ILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQ 67
            +++  L L +       S +S+PHF  NR VITHLM+WK+ DI DECERFLGPYGYGGVQ
Sbjct  5    LIVFSLALTIPYQTLASSPYSDPHFQHNRKVITHLMQWKFVDIADECERFLGPYGYGGVQ 64
Query  68   VSPVNEHAIMDGRPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVLNHMT 127
            VSPVNEHA +D  PWYE YQPVSY I +RSG E QFR MV+RCNKAGVRIYVD+VLNHMT
Sbjct  65   VSPVNEHASLDRHPWYELYQPVSYRIVSRSGTESQFRDMVHRCNKAGVRIYVDVVLNHMT 124
Query  128  GGQSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNCRLVGL 187
            G QSG+G +G HYDG +MQYPG+PFGPNDFHGHE+CPT++L+I+NY +  +ARNCRL GL
Sbjct  125  GPQSGVGIDGTHYDGNSMQYPGIPFGPNDFHGHESCPTSNLDIQNYDDPTQARNCRLSGL 184
Query  188  RDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNEFFTEN 247
            RDLKQ ++YV+ KQ DFLNHLIDIGVAGFR DAS H WP DL++IYS+LH+LN ++F  N
Sbjct  185  RDLKQSADYVRTKQADFLNHLIDIGVAGFRFDASKHMWPGDLQAIYSKLHHLNEKYFPSN 244
Query  248  SHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFGTEWGLV 307
            S+PFIYHE IY   N I+ ++YT LGR IEF +Y E+ NV R NN+L+WL NFG  WG+V
Sbjct  245  SNPFIYHEVIYSNNNAISISDYTKLGRSIEFHYYHELCNVIRGNNKLKWLHNFGQPWGMV 304
Query  308  PSGDALVMIDSHDLRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMSSYFWDQI 367
            P+ DAL+M+DSHDL+ GHTGQLG+NIN FE+RLLK ATAFMLAW YGIPRVMSSY W+Q 
Sbjct  305  PNDDALIMVDSHDLQRGHTGQLGLNINYFESRLLKVATAFMLAWPYGIPRVMSSYRWNQK 364
Query  368  IRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKLIAGQEPV 427
            I +GKD NDW+GPP D  G+ILSV PN D+TCN+EWICEHRW++IYNMV+F+  AG EPV
Sbjct  365  IVNGKDENDWIGPPADGSGSILSVKPNSDLTCNQEWICEHRWKQIYNMVQFRNTAGDEPV 424
Query  428  NNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDIISGNLINN 487
             NWWDNGD QIAFSRG + FIAINLQ NG    ++L++ L+TGLP G YC++++GN+ N 
Sbjct  425  KNWWDNGDYQIAFSRGAKTFIAINLQ-NG----QHLKQNLHTGLPSGNYCNLVTGNVHNG 479
Query  488  RCMGKSIQVDKNGLSDIYVGHDEFD 512
            +C G+ ++VD +G + I +G +  D
Sbjct  480  KCSGQMVHVDGSGHAMISIGANADD 504

Sequence Alignment: 5. Allergen Name: Bla g 11.0101 Sequence ID: Q2L7A6

 Score = 294.1 bits 1263,  Expect = 1e-80
 Identities = 252/493 51%, Positives = 340/493 68%, Gaps = 32/493 6%
Query  6    FFILITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGG 65
            +F L+ +L L+V ++   D     PH    RS I HL EWK+ DI DECERFLGP G+ G
Sbjct  3    LFPLVALLVLVVGVLSQKD-----PHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAG 57
Query  66   VQVSPVNEHAIMDG--RPWYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVL 123
            VQVSPV+E+ I+    RPW+ERYQ VSY + +RSGDE  FR MV+RCN  G+RIYVD+VL
Sbjct  58   VQVSPVHENVIISSPFRPWWERYQLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVL 117
Query  124  NHMTGGQ-SGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNC 182
            N+M+G      G  G   D   +QYP VP+GP DFH   TC      + NY +    RNC
Sbjct  118  NQMSGSWPDAHGQGGSTADTYNLQYPAVPYGPGDFHS--TCT-----VSNYQDPSNVRNC 170
Query  183  RLVGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNE 242
             LVGL DL Q S+YV+ K +++LNHL+D GVAGFR DA+ H WP DL+ IYS+++NLN +
Sbjct  171  ELVGLHDLNQGSDYVRGKMIEYLNHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTD 230
Query  243  F-FTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFG 301
              F   + PF Y+E I  GG  I+S EYT +GR+ EF++ ++I + FR NN ++WL NFG
Sbjct  231  HGFPSGARPFFYQEVIDLGGEAIHSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFG 290
Query  302  TEWGLVPSGDALVMIDSHDLRVGHTGQLGFNINCFE-ARLLKAATAFMLAWNYGIPRVMS 360
              WG +P GDALV +D+HD + GH G  G +I  ++ ++L K A AFMLA+ YG PRVMS
Sbjct  291  VGWGYIPDGDALVFVDNHDNQRGH-GAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMS 349
Query  361  SYFWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKL 420
            S+ +D         N   GPP D +GNI+S   N D TC + W+CEHRWR+I+NMV F+ 
Sbjct  350  SFSFD---------NSDQGPPQDGNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRN 400
Query  421  IAGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDII 480
                  V+NWWDNGD QI+F RGN+ F+A N     ++ + +L++ LQT LP G YCD+I
Sbjct  401  AVAGTAVSNWWDNGDKQISFCRGNKGFVAFN-----DEFNNDLKQTLQTCLPAGDYCDVI 455
Query  481  SGNLINNRCMGKSIQVDKNGLSDIYVGHDEFDAFVAYHIDARVES 525
            SG+  N  C GK++ V  +G + I +     D  +A H++++V S
Sbjct  456  SGSYENGSCTGKTVTVGSDGKAYIEILSSADDGVLAIHVNSKVGS 500

Sequence Alignment: 6. Allergen Name: Per a 11.0101 Sequence ID: AKH04310

 Score = 101.1 bits 416,  Expect = 2e-22
 Identities = 232/484 47%, Positives = 319/484 65%, Gaps = 39/484 8%
Query  9    LITVLTLLVSLFVNGDSKFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQV 68
            L  +L L+V  ++ G     +P ++ + S +  L EWK+DDI DECERFL P GY GVQV
Sbjct  3    LFALLALVV--LLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV 60
Query  69   SPVNEHAIMDGR-P--WYERYQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVLNH 125
            SPV+++ +     P  W ERYQP+SY + +RSGDE  FR MV+RCN  GVRIYVD+VLNH
Sbjct  61   SPVHKNLLYTATAPGLW-ERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNH 119
Query  126  MTGG-QSGLGTNGHHYDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNCRL 184
            M+G   + +GT G   D     YPGVP+  +DFH +  C  ND     Y +    RNC L
Sbjct  120  MSGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPY--CILND-----YQDPEIVRNCEL 172
Query  185  VGLRDLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNEF- 243
            VGL DL Q  +YV++K +DFLNHL+D GVAGFR DA+ H WP DL  IY +++N N++  
Sbjct  173  VGLHDLDQSQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAG 232
Query  244  FTENSHPFIYHETIYYGGNGINSNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFGTE 303
            +  +S P  Y+E I  GG  ++  EY  +GR+ EF+  ++I   FR NN+L W   +   
Sbjct  233  YCGDSSPSRYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPN 292
Query  304  WGLVPSGDALVMIDSHD-LRVGHTGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMSSY 362
            WGL+PSGDALV +D+HD  R G    L +       +  K A AF+LA  YG PRVMSS+
Sbjct  293  WGLLPSGDALVFVDNHDNQRGGGNAILTYKT----PKNYKMAIAFILAHPYGYPRVMSSF 348
Query  363  FWDQIIRDGKDVNDWVGPPTDQHGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFK-LI 421
             ++         +D  GPP D   NILS   N D TC + W+CEHRWR+  NMV F+  +
Sbjct  349  DFE--------AHDQ-GPPQDSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAV 399
Query  422  AGQEPVNNWWDNGDNQIAFSRGNRAFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDIIS 481
             G E + NWWDNG++QI F RG+R F+A N++      D +L++ LQT LP G YCD+IS
Sbjct  400  RGTE-ITNWWDNGNHQIGFCRGDRGFVAFNVE------DNDLKQTLQTCLPAGTYCDVIS 452
Query  482  GNLINNRCMGKSIQVDKNGLS-DIYVGHDEFDAFVAYHIDARV 523
            G+  N   +G  + V  NG +  + +  D+ D  +A H++ ++
Sbjct  453  GSKNNRAHLGAELVVAPNGEAFSVRLISDD-DGVLAIHLEEKL 494

Sequence Alignment: 7. Allergen Name: Aed a 4.0101 Sequence ID: P13080

 Score = 47.7 bits 182,  Expect = 2e-06
 Identities = 61/215 28%, Positives = 119/215 55%, Gaps = 35/215 16%
Query  8    ILITVLTLLVSLFVNGDSKFSNPHF--IGNRSVITHLMEWKYDDIGD-----ECERFLGP 60
            I++ +L++L++ +  G   + + +F  +  RS    + +   D IGD     E  ++L  
Sbjct  3    IFVPLLSFLLAGLTTGLDWWEHGNFYQVYPRS----FKDSDGDGIGDLDGVTEKLKYLKD 58
Query  61   YGYGGVQVSPVNEHAIMD-GRPWYERYQPVSY-DIHTRSGDEQQFRRMVQRCNKAGVRIY 118
             G  GV +SP+    + D G      Y   ++ +I+T  GD   F+R+  +C + G+ + 
Sbjct  59   IGMDGVWLSPIFSSPMADFG------YDISNFREIQTEYGDLDAFQRLSDKCKQLGLHLI 112
Query  119  VDIVLNHMTGGQSGLGTNGHH---YDGVAMQYPGVPFGPNDFHGHETCPTNDLEIHNYSN 175
            +D V NH +  +  +  + +    Y    + +PGV  GPN+    +  P+N + +   S+
Sbjct  113  LDFVPNHTSDQHEYFKKSVQKDETYKDFYVWHPGV-HGPNNT---KVPPSNWISVFRGSS 168
Query  176  ------RIEARNCRLVGLR-DLKQQSEYVKQKQVDFLNHLIDIGVAGFRSDASTHQWPDD 228
                  R E    +++  + DL  ++  V ++  + L + +D GV+GFR DA  + +  D
Sbjct  169  WEWNEERQEFYLHQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVSGFRIDAVPYLFESD 228
Query  229  LRSIYSRLHN 238
            +  I  R  N
Sbjct  229  I--IDGRYRN 236

Sequence Alignment: 8. Allergen Name: Der p 4 Sequence ID: P49274

 Score = 32.9 bits 100,  Expect = 0.002
 Identities = 15/19 78%, Positives = 16/19 84%, Gaps = 0/19 0%
Query  26   KFSNPHFIGNRSVITHLME 44
            K+ NPHFIG RSVIT LME
Sbjct  1    KYXNPHFIGXRSVITXLME 19

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.