The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAGP
PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT
GAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD
GRKGESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA
GPLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN
GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS
GVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT
GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR
GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ
GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI
GARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE
GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFA
GPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT
GFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDK
GPSGESGPPGPPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR
GPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPN
GPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG
GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL
GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL
TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPES
IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY
HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE
YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK
Sequence Info Allergen Name Length Opt Bits Score E Value
XP_013998297 Sal s 6.0201 1356 9859 1249.3 0
XP_014033985 Sal s 6.0202 1356 9662 1224.6 0
XP_018522130 Lat c 6.0301 1355 8112 1030.4 0
XP_018553992 Lat c 6.0201 1447 4929 631.4 2.6e-181
XP_018521723 Lat c 6.0101 1449 4863 623.2 8.2e-179
XP_014059932 Sal s 6.0101 1449 4863 623.2 8.2e-179
XP_014048044 Sal s 6.0102 1449 4858 622.5 1.3e-178
CAA27052 Tri a glutenin 838 560 83.7 1.2e-16
CAA31395 Tri a glutenin 839 531 80.1 1.5e-15
P10388 Tri a 26.0101 839 530 79.9 1.6e-15
CAA43331 Tri a glutenin 830 429 67.3 1e-11
AAB02788 Tri a glutenin 815 402 63.9 1.1e-10
CAA43361 Tri a glutenin 705 376 60.6 9e-10
CAA26847 Tri a glutenin 660 324 54.1 7.8e-08
CAA31396 Tri a glutenin 648 225 41.6 0.00042
A0A0X9C7K4 Par h 1.0101 156 185 36.2 0.0043
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal s 6.0201 Sequence ID: XP_013998297

 Score = 1249.3 bits 9859,  Expect = 0
 Identities = 1356/1356 100%, Positives = 1356/1356 100%, Gaps = 0/1356 0%
Query  1    MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAGP 60
            MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAGP
Sbjct  1    MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAGP 60
Query  61   PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT 120
            PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT
Sbjct  61   PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT 120
Query  121  GAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD 180
            GAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD
Sbjct  121  GAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD 180
Query  181  GRKGESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA 240
            GRKGESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA
Sbjct  181  GRKGESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA 240
Query  241  GPLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN 300
            GPLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN
Sbjct  241  GPLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN 300
Query  301  GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS 360
            GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS
Sbjct  301  GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS 360
Query  361  GVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT 420
            GVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT
Sbjct  361  GVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT 420
Query  421  GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR 480
            GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR
Sbjct  421  GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR 480
Query  481  GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ 540
            GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ
Sbjct  481  GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ 540
Query  541  GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI 600
            GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI
Sbjct  541  GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI 600
Query  601  GARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE 660
            GARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE
Sbjct  601  GARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE 660
Query  661  GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFA 720
            GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFA
Sbjct  661  GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFA 720
Query  721  GPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT 780
            GPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT
Sbjct  721  GPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT 780
Query  781  GFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDK 840
            GFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDK
Sbjct  781  GFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDK 840
Query  841  GPSGESGPPGPPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR 900
            GPSGESGPPGPPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR
Sbjct  841  GPSGESGPPGPPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR 900
Query  901  GPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPN 960
            GPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPN
Sbjct  901  GPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPN 960
Query  961  GPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG 1020
            GPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG
Sbjct  961  GPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG 1020
Query  1021 GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL 1080
            GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL
Sbjct  1021 GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL 1080
Query  1081 GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL 1140
            GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL
Sbjct  1081 GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL 1140
Query  1141 TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPES 1200
            TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPES
Sbjct  1141 TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPES 1200
Query  1201 IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY 1260
            IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY
Sbjct  1201 IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY 1260
Query  1261 HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE 1320
            HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE
Sbjct  1261 HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE 1320
Query  1321 YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK 1356
            YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK
Sbjct  1321 YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK 1356

Sequence Alignment: 2. Allergen Name: Sal s 6.0202 Sequence ID: XP_014033985

 Score = 1224.6 bits 9662,  Expect = 0
 Identities = 1322/1356 97%, Positives = 1336/1356 98%, Gaps = 0/1356 0%
Query  1    MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAGP 60
            MLSFVDNRILLLLAVTS+LASCQSGGLKGP G KGPRGDRGPQG NGRDGK GLPGVAGP
Sbjct  1    MLSFVDNRILLLLAVTSFLASCQSGGLKGPTGVKGPRGDRGPQGRNGRDGKDGLPGVAGP 60
Query  61   PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT 120
            PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT
Sbjct  61   PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT 120
Query  121  GAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD 180
            G IGARGPPG+AGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD
Sbjct  121  GPIGARGPPGAAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD 180
Query  181  GRKGESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA 240
            GRKGESG+ GAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA
Sbjct  181  GRKGESGSGGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA 240
Query  241  GPLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN 300
            GPLGAAGPPGFPGAPGPKGEIGGVG+NGPSGPQGGRGEPG NGAVGPVGPVGNPGNNGIN
Sbjct  241  GPLGAAGPPGFPGAPGPKGEIGGVGANGPSGPQGGRGEPGTNGAVGPVGPVGNPGNNGIN 300
Query  301  GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS 360
            GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS
Sbjct  301  GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS 360
Query  361  GVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT 420
            GVQGPAGPAGEEGKRGSTGE GATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT
Sbjct  361  GVQGPAGPAGEEGKRGSTGEVGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT 420
Query  421  GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR 480
            GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR
Sbjct  421  GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR 480
Query  481  GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ 540
            GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ
Sbjct  481  GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQ 540
Query  541  GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI 600
            GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI
Sbjct  541  GPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI 600
Query  601  GARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE 660
            GARGPAGTPGPDGGKGEPGSVGI G  GHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE
Sbjct  601  GARGPAGTPGPDGGKGEPGSVGIAGGPGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE 660
Query  661  GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFA 720
            GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGP+GERGEGGPAGPPGFA
Sbjct  661  GNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPNGERGEGGPAGPPGFA 720
Query  721  GPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT 780
            GPPGSDGQ GPRG+KGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT
Sbjct  721  GPPGSDGQPGPRGDKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLT 780
Query  781  GFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDK 840
            GFPGAAGRVGGPGPAGI+GPPGSAGPAGKDGPRGLRGDPGPGGPQGE G +GPAGI GDK
Sbjct  781  GFPGAAGRVGGPGPAGISGPPGSAGPAGKDGPRGLRGDPGPGGPQGEHGQIGPAGIAGDK 840
Query  841  GPSGESGPPGPPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR 900
            GP+GESGPPG PGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR
Sbjct  841  GPTGESGPPGAPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR 900
Query  901  GPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPN 960
            GP+GNIGMPGMTGTQGEAGREG+PGNDGPPGRPG AGFKGDRGEPGSPGALGSSGQPGPN
Sbjct  901  GPAGNIGMPGMTGTQGEAGREGSPGNDGPPGRPGTAGFKGDRGEPGSPGALGSSGQPGPN 960
Query  961  GPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG 1020
            GP+G+ GRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG
Sbjct  961  GPSGAVGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG 1020
Query  1021 GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL 1080
            GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL
Sbjct  1021 GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL 1080
Query  1081 GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL 1140
            GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL
Sbjct  1081 GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENLL 1140
Query  1141 TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPES 1200
            TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKA+CDFSTGHTCIHPHPES
Sbjct  1141 TPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAHCDFSTGHTCIHPHPES 1200
Query  1201 IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY 1260
            IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY
Sbjct  1201 IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY 1260
Query  1261 HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE 1320
            HCKNSVAYMDGENGNLKKAVLLQGSNDVEL AEGNSRFTFNVLEDGCTRHTGQWSKTVIE
Sbjct  1261 HCKNSVAYMDGENGNLKKAVLLQGSNDVELSAEGNSRFTFNVLEDGCTRHTGQWSKTVIE 1320
Query  1321 YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK 1356
            YRTNKPSRLPILDIAPLDIG ADQEFGLDIGPVCFK
Sbjct  1321 YRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCFK 1356

Sequence Alignment: 3. Allergen Name: Lat c 6.0301 Sequence ID: XP_018522130

 Score = 1030.4 bits 8112,  Expect = 0
 Identities = 1104/1354 81%, Positives = 1173/1354 86%, Gaps = 3/1354 0%
Query  1    MLSFVDNRILLLLAVTSLLASCQ-SGGLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAG 59
            MLSFVD RILLLLAVTS LASCQ SG +KGPRG KGPRGDRGPQGPNG+DGKPGLPG  G
Sbjct  1    MLSFVDTRILLLLAVTSYLASCQYSGRVKGPRGDKGPRGDRGPQGPNGKDGKPGLPGPPG 60
Query  60   PPGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQ 119
            PPGPPGLGGNFAAQ++G K  DP  GPMGLMG RGP GPPG PGPQG TGHAGEPGEPGQ
Sbjct  61   PPGPPGLGGNFAAQYEGAKAPDP-IGPMGLMGPRGPPGPPGPPGPQGHTGHAGEPGEPGQ 119
Query  120  TGAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGL 179
             G +GARGPPG  GK G+DGNNGRPGKPGDRG PG QGARGFPGTPGLPGMKGHRGY GL
Sbjct  120  AGPVGARGPPGPPGKAGDDGNNGRPGKPGDRGAPGPQGARGFPGTPGLPGMKGHRGYTGL 179
Query  180  DGRKGESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGP 239
            DGRKGE G AG KGE GAHGA G PG AGSRGL GERGRAGPAGPAGARGADG+ GPAGP
Sbjct  180  DGRKGEPGAAGPKGEPGAHGAAGTPGLAGSRGLPGERGRAGPAGPAGARGADGNVGPAGP 239
Query  240  AGPLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGI 299
            AGP+GAAGPPGFPG PGPKGEIG  G+ GPSGPQG RGEPG NGAVGPVGP GNPG NG+
Sbjct  240  AGPVGAAGPPGFPGGPGPKGEIGPAGATGPSGPQGARGEPGANGAVGPVGPPGNPGANGL 299
Query  300  NGAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGH 359
            NGAKGAAG PGVAGAPGFPGPRGGPGPQGPQG+TG RGL GDPG  G KGD+G KGEPG+
Sbjct  300  NGAKGAAGTPGVAGAPGFPGPRGGPGPQGPQGATGPRGLAGDPGAQGVKGDAGPKGEPGN 359
Query  360  SGVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGA 419
            +G QG  GP GEEGKRG TGE GA GPAG RGARG  G RG+PG EGR GPIGMPGARGA
Sbjct  360  AGPQGAPGPQGEEGKRGPTGEIGAPGPAGGRGARGAPGGRGMPGAEGRTGPIGMPGARGA 419
Query  420  TGPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGP 479
            TG AG RG PGDAGRAGE G  G RGLPG+ G  GPPGKEGP+G AG DGR+GPPGPTGP
Sbjct  420  TGSAGPRGPPGDAGRAGEPGAAGLRGLPGSPGSSGPPGKEGPAGPAGQDGRSGPPGPTGP 479
Query  480  RGQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGE 539
            RGQ GNIGFPGPKGP GE GK G+KG TG TGLRG PG DGNNGA G  G  G  GEKGE
Sbjct  480  RGQAGNIGFPGPKGPSGEPGKPGEKGATGPTGLRGAPGPDGNNGATGATGPAGGPGEKGE 539
Query  540  QGPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGA 599
            QGPSGAPGFQGLPGPAGPAGEAGK G++G+PGDQG+ G AG KGERGN G AG+ G QG 
Sbjct  540  QGPSGAPGFQGLPGPAGPAGEAGKPGDRGIPGDQGVAGAAGGKGERGNPGAAGATGPQGP 599
Query  600  IGARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGL 659
            IG RGPAG PGPDGGKGEPG+VG  GA GHQGPGGMPGERGA G PG KGEKGE GHRG 
Sbjct  600  IGPRGPAGAPGPDGGKGEPGAVGAAGANGHQGPGGMPGERGAAGPPGGKGEKGEPGHRGP 659
Query  660  EGNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGF 719
            +GN GRDGARG PGP+GPPGP+GANG+KGESG+FGPAGPAG RG  GERGE GPAG  GF
Sbjct  660  DGNPGRDGARGLPGPAGPPGPTGANGDKGESGAFGPAGPAGPRGSPGERGEVGPAGAAGF 719
Query  720  AGPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGL 779
            AGPPG+DGQ G RGE+GP+G KG+VGPAGPAGPAGQSGP+G SGPAGP G RGD GP GL
Sbjct  720  AGPPGADGQPGARGERGPSGVKGEVGPAGPAGPAGQSGPAGPSGPAGPAGARGDTGPPGL 779
Query  780  TGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGD 839
            TGFPGAAGRVG  GPAGI GPPG AGP+GKDGPRGLRGDPGP GP GE G VGP G  G+
Sbjct  780  TGFPGAAGRVGAAGPAGIVGPPGPAGPSGKDGPRGLRGDPGPAGPSGEQGMVGPPGPAGE 839
Query  840  KGPSGESGPPGPPGTAGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGP 899
            KGPSGESGPPGPPG  GP GVLG  GFVGLPG+RGD+G PG  GAVGEPGRLGP G +G 
Sbjct  840  KGPSGESGPPGPPGAPGPSGVLGPQGFVGLPGARGDRGSPGAAGAVGEPGRLGPPGPAGA 899
Query  900  RGPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGP 959
            RGP GNIG+PGMTG QGEAGREGNPGNDGPPGRPGA G+KGDRGEPGSPGA+G +G PGP
Sbjct  900  RGPPGNIGLPGMTGPQGEAGREGNPGNDGPPGRPGAPGLKGDRGEPGSPGAMGLAGAPGP 959
Query  960  NGPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGH 1019
             GP G+AGRPGNRGESGP G  GPVGAAGARG  GPAG RGEKG AG+KG+RGMKGLRGH
Sbjct  960  AGPTGAAGRPGNRGESGPGGPAGPVGAAGARGVAGPAGTRGEKGVAGDKGERGMKGLRGH 1019
Query  1020 GGLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGH 1079
             GLQGMPGP GPSG+TG AG +G +GPRGPAGPHGP GKDGRAG HG IG  G RG PG+
Sbjct  1020 PGLQGMPGPAGPSGDTGPAGPSGSSGPRGPAGPHGPAGKDGRAGSHGTIGAPGARGPPGY 1079
Query  1080 LGPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIENL 1139
            +GPAGPPG PGLPGP G AGGGYD SG YDEYRADQP+LRAKDYEVDATIKSLN+QIENL
Sbjct  1080 VGPAGPPGPPGLPGPPGAAGGGYDVSG-YDEYRADQPALRAKDYEVDATIKSLNTQIENL 1138
Query  1140 LTPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPE 1199
            LTPEGS+KNPARTCRDI+LSHP+WSSGFYWIDPNQGCI DA+K +CDF+T  TCI+ HPE
Sbjct  1139 LTPEGSRKNPARTCRDIKLSHPDWSSGFYWIDPNQGCINDAVKVFCDFTTRETCIYAHPE 1198
Query  1200 SIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNIT 1259
            SIARKNW+RS+E KKHVWFGETINGGTEF YNDETLSPQSMATQLAFMRLL+NQA+QNIT
Sbjct  1199 SIARKNWFRSTEGKKHVWFGETINGGTEFTYNDETLSPQSMATQLAFMRLLSNQASQNIT 1258
Query  1260 YHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVI 1319
            YHCKNSVAYMDGE+GNLKKAV+LQGSNDVELRAEGNSRFTF+VLEDGCTRHTG+WSKTVI
Sbjct  1259 YHCKNSVAYMDGESGNLKKAVVLQGSNDVELRAEGNSRFTFSVLEDGCTRHTGEWSKTVI 1318
Query  1320 EYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK 1356
            EYRTNKPSRLPILDIAPLDIG ADQEFGLDIGPVCFK
Sbjct  1319 EYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCFK 1355

Sequence Alignment: 4. Allergen Name: Lat c 6.0201 Sequence ID: XP_018553992

 Score = 631.4 bits 4929,  Expect = 3e-181
 Identities = 824/1332 61%, Positives = 956/1332 71%, Gaps = 22/1332 1%
Query  23   QSGGLKGPRGAKGPRGDRGPQGPNGRDG---KPGLPGVAGPPGPPGLGGNFAAQFDGGKG 79
            Q   ++GP+G +GP+GDRGP GP G DG   +PGLPG  GPPGPPGLGGNF+ Q  GG  
Sbjct  94   QESKVEGPKGERGPKGDRGPPGPPGNDGIPGQPGLPGPPGPPGPPGLGGNFSPQMSGGY- 152
Query  80   SDPGP-----GPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQTGAIGARGPPGSAGK 134
             D  P     GPMG MG RGP GPPGS GPQGFTG  GEPGE G +G +G RGP G  GK
Sbjct  153  EDKSPAVAVIGPMGPMGPRGPPGPPGSSGPQGFTGPPGEPGEAGPSGPMGPRGPGGPPGK 212
Query  135  PGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGE 194
             GEDG +G+PG+PG+RG PG QGARGFPGTPGLPG+KGHRG++GLDG KGE+G AG KGE
Sbjct  213  NGEDGESGKPGRPGERGPPGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGETGPAGPKGE 272
Query  195  TGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPAGPLGAAGPPGFPGA 254
             GA G NG PG  G RGL GERGR G AG AGARG DG+ G AGP GP G AGPPGFPG 
Sbjct  273  AGAPGENGTPGAMGPRGLPGERGRVGAAGSAGARGNDGAAGAAGPPGPTGPAGPPGFPGG 332
Query  255  PGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGINGAKGAAGLPGVAGA 314
            PG KG+ G  G+ G  GP G RGEPG  G  GP GP GNPG +G  GAKGA G  GVAGA
Sbjct  333  PGAKGDAGPQGARGAEGPSGARGEPGNPGPAGPAGPAGNPGTDGAPGAKGAPGAAGVAGA 392
Query  315  PGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHSGVQGPAGPAGEEGK 374
            PGFPGPRG PG QG  G+ G +G  GD G  G KG++GAKGE G  GVQGP GP GEEGK
Sbjct  393  PGFPGPRGPPGTQGAAGAPGPKGNTGDVGSPGAKGEAGAKGEAGAPGVQGPPGPPGEEGK 452
Query  375  RGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGATGPAGIRGAPGDAGR 434
            RG+ GE GA G  G  G RGG G RG+PG +G  GP G PG RGA G  G +GA G+ GR
Sbjct  453  RGARGEPGAAGVRGAPGERGGPGGRGFPGADGSAGPKGAPGERGAPGLVGPKGATGEPGR 512
Query  435  AGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPRGQPGNIGFPGPKGP 494
             GE GL GA+G+ G+ G  GP GK GPSGA G DGR GPPG  G RGQPG +GFPGPKG 
Sbjct  513  TGEPGLPGAKGMTGSPGSPGPDGKMGPSGAPGQDGRPGPPGAVGARGQPGVMGFPGPKGA 572
Query  495  GGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGP 554
             GE GK G++G  G TG  G PG DG+ GAPGPAG  G AGE+GEQG +GAPGFQGLPGP
Sbjct  573  AGEGGKPGERGVMGPTGPVGAPGKDGDVGAPGPAGPAGPAGERGEQGAAGAPGFQGLPGP 632
Query  555  AGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGG 614
             G  GE GK G QG+PG+ G PGPAG +G+RG  G  G+ G  G  GARG  G  G DG 
Sbjct  633  QGAVGETGKPGEQGLPGEAGAPGPAGARGDRGFPGERGAPGPIGPAGARGSPGAAGNDGA 692
Query  615  KGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGAPGP 674
            KG+ G+ G  GA G  G  GMPGERGA G PG +G++G+ G +G +G  G+DG RG  GP
Sbjct  693  KGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGPRGLTGP 752
Query  675  SGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFAGPPGSDGQSGPRGE 734
             G PGP+GA G+KGE G+ G  GPAG RGP GERGE GP GP GFAGPPG+DGQ G +GE
Sbjct  753  IGLPGPAGATGDKGEPGAVGLVGPAGARGPPGERGEAGPPGPAGFAGPPGADGQPGAKGE 812
Query  735  KGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGP 794
             G  G KGD GP G AGP G  GP G  G  G  G RG AGP G TGFPGAAGRVG PGP
Sbjct  813  PGDNGAKGDAGPPGAAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGAAGRVGPPGP 872
Query  795  AGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDKGPSGESGPPGPPGT 854
            +G  GPPG AGP+GK+GP+G RG+ GP G  GE GA GP G +G+KG  G  G PG  G 
Sbjct  873  SGNPGPPGPAGPSGKEGPKGNRGETGPAGRPGEVGAAGPPGSSGEKGSPGADGAPGSAGL 932
Query  855  AGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPSGNIGMPGMTGT 914
             GPQG+ G+ G VGLPG RG++G+PG  G  GE G+ GPAG  G RGP G +G PG+ G 
Sbjct  933  PGPQGIAGQRGIVGLPGQRGERGFPGLHGPAGETGKQGPAGPGGERGPPGPMGPPGLAGA 992
Query  915  QGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPNGPAGSAGRPGNRGE 974
             GE GREG PGN+G  GR GAAG KG+RGE G+ GA G+ G PG  GP G AG+ G+RGE
Sbjct  993  PGEPGREGAPGNEGAAGRDGAAGQKGERGETGAAGAPGAPGPPGAPGPVGPAGKNGDRGE 1052
Query  975  SGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHGGLQGMPGPNGPSGE 1034
            +GP G  GP G AG RG  G  G RG+KG  GE G+RGMKG RG  G+QG PGP+GP G+
Sbjct  1053 TGPAGPAGPAGPAGPRGPAGAPGLRGDKGETGEAGERGMKGHRGFTGMQGPPGPSGPPGD 1112
Query  1035 TGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHLGPAGPPGSPGLPGP 1094
             G AG  GPAGPRGPAG  G PGKDG +G  G  GP G RG  G +GPAGPPG PG PG 
Sbjct  1113 QGPAGSAGPAGPRGPAGSAGSPGKDGMSGLPGPTGPPGPRGRSGEMGPAGPPGPPGPPGA 1172
Query  1095 AGPAGGGYD-------QSGGYDE---YRADQPS-LRAKDYEVDATIKSLNSQIENLLTPE 1143
             G  GGG+D       Q    D    YRAD  + LR +D EVD+T+KSL+ QIE + +P+
Sbjct  1173 PGAPGGGFDLGFIAQPQEKAPDPFRMYRADDANVLRDRDLEVDSTLKSLSQQIEQIRSPD 1232
Query  1144 GSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIAR 1203
            G++KNPARTCRD+++ HP+W SG YWIDP+QGC  DAIK YC+  TG TC+ P    +A+
Sbjct  1233 GTRKNPARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYCNMETGETCVPPTQREVAQ 1292
Query  1204 KNWYRSS--ENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYH 1261
            KNWY S   + KKH+WFGE +N G +F Y  E   P+ +  QL F+RL++ +A+QNITYH
Sbjct  1293 KNWYVSKNIKEKKHIWFGEAMNDGFQFEYGSEGSLPEDVNIQLTFLRLMSTEASQNITYH 1352
Query  1262 CKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEY 1321
            CKNSVAYMD   GNLKKA+LLQGSN++E+RAEGNSRFT++VLEDGCT HTG W KTVI+Y
Sbjct  1353 CKNSVAYMDANAGNLKKALLLQGSNEIEIRAEGNSRFTYSVLEDGCTSHTGTWGKTVIDY 1412
Query  1322 RTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355
            +T+K SRLPI+DIAP+D+G  DQEFGL++GPVCF
Sbjct  1413 KTSKTSRLPIIDIAPMDVGAPDQEFGLEVGPVCF 1446

Sequence Alignment: 5. Allergen Name: Lat c 6.0101 Sequence ID: XP_018521723

 Score = 623.2 bits 4863,  Expect = 8e-179
 Identities = 813/1325 61%, Positives = 940/1325 70%, Gaps = 20/1325 1%
Query  31   RGAKGPRGDRGPQGPNGRDG---KPGLPGVAGPPGPPGLGGNFAAQ--FDGGK-GSDPGP 84
            +G  GP+GDRGP GP G DG   +PGLPG  GPPGPPGLGGNF+ Q  +D  K G     
Sbjct  104  KGDVGPKGDRGPVGPPGNDGIPGQPGLPGPPGPPGPPGLGGNFSPQMSYDSSKSGGGQVI 163
Query  85   GPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQTGAIGARGPPGSAGKPGEDGNNGRP 144
            GPMG MG RGP GP GS GPQGFTG  GEPGEPG  G +GARGP G  GK G+DG  G+ 
Sbjct  164  GPMGPMGPRGPPGPSGSSGPQGFTGPPGEPGEPGAAGPMGARGPAGPPGKNGDDGEPGKA 223
Query  145  GKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGETGAHGANGNP 204
            G+PG+RG  G QGARGFPGTPGLPG+KGHRG++GLDG KG++G AG KGE GA G NG P
Sbjct  224  GRPGERGAAGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEPGAPGENGVP 283
Query  205  GPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPAGPLGAAGPPGFPGAPGPKGEIGGV 264
            G  G+RGL GERGR GP GP+GARG DG+TG AGP GP G AGPPGFPG  G KGE G  
Sbjct  284  GIMGARGLPGERGRPGPPGPSGARGNDGNTGAAGPPGPTGPAGPPGFPGGAGAKGETGPQ 343
Query  265  GSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGINGAKGAAGLPGVAGAPGFPGPRGGP 324
            G  G  GPQG RGEPG  G  GP GP G PG +G  G KGA G  G+AGAPGFPG RG  
Sbjct  344  GGRGSEGPQGARGEPGNPGPAGPAGPAGAPGTDGAPGNKGAPGAAGIAGAPGFPGARGPA 403
Query  325  GPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHSGVQGPAGPAGEEGKRGSTGEAGAT 384
            G QG  G+ G +G  GD GPSG KG+ GAKGEPG +GVQG  GP+GEEGKRG+ GE G  
Sbjct  404  GAQGGVGAPGPKGNNGDIGPSGPKGEPGAKGEPGPAGVQGLPGPSGEEGKRGARGEPGGA 463
Query  385  GPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGATGPAGIRGAPGDAGRAGESGLTGAR 444
            GP G  G RG  G RG+PG +G  G  G PG RG+ GP G +GA G+AG  G  G  G++
Sbjct  464  GPRGPPGERGAPGARGFPGADGAAGGKGAPGERGSPGPMGAQGATGEAGSPGAPGAPGSK 523
Query  445  GLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPRGQPGNIGFPGPKGPGGEAGKGGDK 504
            G+ G+ G  GP GK GP+G AG DGR GPPGP G RG PG +GFPGPKG  G+AGK G++
Sbjct  524  GMTGSPGSPGPDGKAGPAGVAGQDGRPGPPGPAGARGPPGVMGFPGPKGAAGDAGKPGER 583
Query  505  GPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGPAGPAGEAGKA 564
            GP GA+G  G PG DG+ GAPGPAG  G AGEKGEQGP G PGFQGLPGP G  GE GK 
Sbjct  584  GPGGASGPVGAPGKDGDVGAPGPAGAAGPAGEKGEQGPVGPPGFQGLPGPQGATGETGKP 643
Query  565  GNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGEPGSVGIV 624
            G QG PG+ G PGPAG +G+RG  G  G+ G  G +GARG  G  G DG KGEPG+ G  
Sbjct  644  GEQGAPGEAGPPGPAGPRGDRGFPGERGAPGITGPVGARGAPGPAGSDGPKGEPGAAGAP 703
Query  625  GAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGAPGPSGPPGPSGAN 684
            G  G  G  GMPGERGA G PG KGE+G+ G +G +G  G+DGARG  G  G PGP GA 
Sbjct  704  GGQGAPGMQGMPGERGAAGLPGVKGERGDAGIKGADGGPGKDGARGMTGAIGVPGPPGAQ 763
Query  685  GEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFAGPPGSDGQSGPRGEKGPAGGKGDV 744
            GEKGE G  G  GP G RG  GERGE GP GP GFAGPPG+DGQ G +GE G  G KGD 
Sbjct  764  GEKGEGGPVGVTGPTGPRGSPGERGETGPPGPAGFAGPPGADGQPGAKGETGDTGPKGDA 823
Query  745  GPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGPAGIAGPPGSA 804
            G  GP GP G +GP G +GP GP G RG AG  G TGFPG AGRVG PGPAG AG PG  
Sbjct  824  GAPGPGGPVGAAGPQGPAGPPGPKGARGGAGSPGATGFPGPAGRVGPPGPAGAAGAPGPI 883
Query  805  GPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDKGPSGESGPPGPPGTAGPQGVLGHA 864
            GP GKDG RG RG+ GP G  GE GA G AG +G+KG  G  G PG  G  GPQG+ G+ 
Sbjct  884  GPVGKDGARGARGETGPAGRPGEAGAAGIAGPSGEKGSPGSDGAPGAAGLPGPQGIAGQR 943
Query  865  GFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPSGNIGMPGMTGTQGEAGREGNP 924
            G VGLPG RG++G+ G PG  GEPG+ GP+G  G RGP G  G PG++G  GEAGREG+ 
Sbjct  944  GIVGLPGQRGERGFAGLPGQAGEPGKQGPSGPVGERGPPGPAGPPGLSGAPGEAGREGSM 1003
Query  925  GNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPNGPAGSAGRPGNRGESGPTGNGGPV 984
            G+DG PGR GA G KGDRGE G  G  G  G PG  G  G +G+ G+RGESGP G  GP 
Sbjct  1004 GHDGAPGRDGAPGPKGDRGESGMAGPPGPPGAPGAPGAVGPSGKSGDRGESGPAGPAGPA 1063
Query  985  GAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHGGLQGMPGPNGPSGETGSAGITGPA 1044
            G AG RG  GPAG +G++G AGE G+RG KG RG  G+QG+PG  G +GE G AG  GPA
Sbjct  1064 GPAGVRGPAGPAGAKGDRGEAGEAGERGHKGHRGFTGMQGLPGVAGAAGERGPAGANGPA 1123
Query  1045 GPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHLGPAGPPGSPGLPGPAGPAGGGYD- 1103
            GPRGPAG +GPPGKDG  G  G IGP G RG  G +GPAGPPG PG  GP GP GGG+D 
Sbjct  1124 GPRGPAGSNGPPGKDGMNGLPGPIGPPGPRGRNGEMGPAGPPGPPGPAGPPGPPGGGFDF 1183
Query  1104 -----QSGGYD-----EYRADQPSL-RAKDYEVDATIKSLNSQIENLLTPEGSKKNPART 1152
                 Q    D      YRAD P++ R +D EVD T+K+L  ++E + +P+G++K+PAR 
Sbjct  1184 ISQPIQEKAPDPYRGGHYRADDPNMMRDRDMEVDTTLKTLTQKVEKIRSPDGTQKSPARM 1243
Query  1153 CRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSE- 1211
            CRD+R+ HPEW SG YW+DPNQG   DAIK +C+  TG TCIHP   SI  KNWY S   
Sbjct  1244 CRDLRMCHPEWKSGTYWVDPNQGSPLDAIKVHCNMETGETCIHPSESSIPMKNWYLSKNI 1303
Query  1212 -NKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMD 1270
              KKHVWF E++ GG +F Y  +   P+ ++ Q+ FMRL++NQA+QNITYHCKNS+AYMD
Sbjct  1304 REKKHVWFSESMTGGFQFQYGTDGADPEDVSIQMTFMRLMSNQASQNITYHCKNSIAYMD 1363
Query  1271 GENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLP 1330
               GNLKKA+LLQGSNDVE+RAEGNSRFT++V EDGCT HTG W KTVI+Y+T+K SRLP
Sbjct  1364 SATGNLKKALLLQGSNDVEIRAEGNSRFTYSVSEDGCTSHTGTWGKTVIDYKTSKTSRLP 1423
Query  1331 ILDIAPLDIGEADQEFGLDIGPVCF 1355
            I+DIAP+D+G  DQEFG+++GPVCF
Sbjct  1424 IIDIAPMDVGAPDQEFGVEVGPVCF 1448

Sequence Alignment: 6. Allergen Name: Sal s 6.0101 Sequence ID: XP_014059932

 Score = 623.2 bits 4863,  Expect = 8e-179
 Identities = 807/1333 60%, Positives = 952/1333 71%, Gaps = 22/1333 1%
Query  23   QSGGLKGPRGAKGPRGDRGPQGPNGRDG---KPGLPGVAGPPGPPGLGGNFAAQFDGGKG 79
            Q   ++GP+G +G +G+ GP G  G DG   +PGLPG  GPPGPPGLGGNF+ Q  GG  
Sbjct  94   QEPKVEGPQGDRGAKGEPGPAGFPGNDGIPGQPGLPGPPGPPGPPGLGGNFSPQMSGGFD 153
Query  80   SDPG-----PGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQTGAIGARGPPGSAGK 134
               G     PGPMG MG RGP GPPGS GPQGFTG  GEPGE G +G +G RGP G  GK
Sbjct  154  EKSGGGMSMPGPMGPMGPRGPPGPPGSSGPQGFTGPPGEPGEAGSSGPMGPRGPAGPPGK 213
Query  135  PGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGE 194
             G+DG +G+PG+PG+RG  G QGARGFPGTPGLPG+KGHRG++GLDG KGESG AG KGE
Sbjct  214  NGDDGESGKPGRPGERGASGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGESGPAGPKGE 273
Query  195  TGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPAGPLGAAGPPGFPGA 254
             GA G NG  G  G RGL GERGRAGP G AGARG DG+ G AGP GP G AG PGFPG 
Sbjct  274  AGASGENGAAGAMGPRGLPGERGRAGPNGAAGARGNDGAAGAAGPPGPTGPAGAPGFPGG 333
Query  255  PGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGINGAKGAAGLPGVAGA 314
            PG KGE+G  G+ G  GPQG RGE G  G  G  GP GN G +G  G KGA G  G+AGA
Sbjct  334  PGAKGEVGAQGARGGEGPQGSRGEAGNPGPAGAAGPAGNNGADGNPGTKGAPGSSGIAGA 393
Query  315  PGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHSGVQGPAGPAGEEGK 374
            PGFPGPRG PGPQG  G+ G +G  G+ G +G KG++GAKGE G +GVQGPAGPAGEEGK
Sbjct  394  PGFPGPRGPPGPQGAGGAPGPKGNTGEVGATGAKGEAGAKGESGPAGVQGPAGPAGEEGK 453
Query  375  RGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGATGPAGIRGAPGDAGR 434
            RG  GE G+ G  G  G RG  G+RG+PG +G  GP G PG RG  G AG +G  G+ GR
Sbjct  454  RGGRGEPGSAGARGAPGERGAPGSRGFPGSDGAAGPKGGPGERGGAGVAGAKGNTGEPGR 513
Query  435  AGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPRGQPGNIGFPGPKGP 494
             GE G+ G++G+ G+ G  GP GK GPSGA G DGR GPPGP G RGQPG +GFPGPKG 
Sbjct  514  NGEPGMPGSKGMTGSPGSPGPDGKTGPSGAGGQDGRPGPPGPVGARGQPGVMGFPGPKGA 573
Query  495  GGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGP 554
             GE GK G++G  G  G  G PG DG+ GAPG  G  G +GE+GEQG  G PGFQGLPGP
Sbjct  574  AGEGGKPGERGVMGPVGAVGAPGKDGDVGAPGAPGAAGPSGERGEQGAGGPPGFQGLPGP 633
Query  555  AGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGG 614
             G  GE GK G QG+PG+ G PG AG +G+RG  G  G+ G  G  GARG  G+ G DG 
Sbjct  634  QGAIGETGKPGEQGLPGEGGAPGAAGSRGDRGFPGERGAPGPSGPAGARGSPGSAGNDGA 693
Query  615  KGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGAPGP 674
            KGE G+ G  G  G  G  GMPGERGAGG PG KG++G+ G +G +G  G+DG RG  GP
Sbjct  694  KGEAGAAGAPGGQGPPGLQGMPGERGAGGLPGLKGDRGDQGVKGADGAGGKDGIRGMTGP 753
Query  675  SGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFAGPPGSDGQSGPRGE 734
             GP GP+G+ G+KGE+G+ GP GP G RG  GERGE G  GP GFAGPPG DGQ G +GE
Sbjct  754  IGPNGPAGSPGDKGETGAPGPGGPTGARGAPGERGESGAPGPAGFAGPPGGDGQPGAKGE 813
Query  735  KGPAGGKGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGP 794
             G  G KGD G  GPAGP G  GP G +G  G  G RG AGP G TGFPGAAGRVG PGP
Sbjct  814  AGDNGAKGDGGAQGPAGPTGAPGPQGPAGNTGAKGARGAAGPPGATGFPGAAGRVGPPGP 873
Query  795  AGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDKGPSGESGPPGPPGT 854
            +G  GPPG  GP GK+G +G RG+ GP G  GE GA GP G  G+KG  G  GP GP GT
Sbjct  874  SGNNGPPGPPGPGGKEGQKGNRGETGPSGRPGELGAAGPPGAQGEKGQPGADGPNGPAGT 933
Query  855  AGPQGVLGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPSGNIGMPGMTGT 914
             GPQG+ G+ G VGLPG RG++G+PG PG +GEPG+ GP G SG RGP G +G PG+ G 
Sbjct  934  PGPQGIGGQRGIVGLPGQRGERGFPGLPGQLGEPGKQGPGGPSGERGPPGPMGPPGLAGA 993
Query  915  QGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPNGPAGSAGRPGNRGE 974
             GE+GREG PGN+G  GR GAAG KG+RGE G+ GA G+ G PG  GP G AG+ G+RGE
Sbjct  994  PGESGREGTPGNEGSSGRDGAAGPKGERGESGAAGASGAPGPPGAPGPVGPAGKSGDRGE 1053
Query  975  SGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHGGLQGMPGPNGPSGE 1034
            SGP G  G  G AG RG  GPAG RG+KG AGE G+RGMKG RG  G+QG  GP GPSGE
Sbjct  1054 SGPAGPAGIAGPAGPRGPSGPAGARGDKGEAGEAGERGMKGHRGFTGMQGPSGPAGPSGE 1113
Query  1035 TGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHLGPAGPPGSPGLPGP 1094
            +G AG +GPAGPRGP+G  G  GKDG +G  G IGP G RG  G +GP+GPPG PG PGP
Sbjct  1114 SGPAGASGPAGPRGPSGSAGAAGKDGMSGLPGPIGPPGPRGRSGEMGPSGPPGPPGPPGP 1173
Query  1095 AGPAGGGYDQS-----------GGYDEYRADQPS-LRAKDYEVDATIKSLNSQIENLLTP 1142
             GP GGG+D               +  +RAD  + +R +D EVD T+KSL+ QIEN+ +P
Sbjct  1174 PGPPGGGFDMGFIAQPAQEKAPDPFRHFRADDANVMRDRDLEVDTTLKSLSQQIENIRSP 1233
Query  1143 EGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIA 1202
            EG+KKNPARTCRD+++ HP+W SG YWIDP+QGC  DAIK YC+  TG TC++P    I 
Sbjct  1234 EGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYCNMETGETCVYPTEAEIP 1293
Query  1203 RKNWYRSS--ENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY 1260
            +K+WY S   + KKHVWFGE +  G +F Y  E  S Q +  QL F+RL+A +A+QNITY
Sbjct  1294 KKSWYTSKNIKEKKHVWFGEAMTDGFQFEYGSEGSSAQDVNIQLTFLRLMATEASQNITY 1353
Query  1261 HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE 1320
            HCKNS+AYMD ++GNLKK++LLQGSN++E+RAEGNSRFT++V EDGCT HTG W KTVI+
Sbjct  1354 HCKNSIAYMDQQSGNLKKSLLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVID 1413
Query  1321 YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355
            Y+T K SRLPI+DIAP+D+G  +QEFG+++GPVCF
Sbjct  1414 YKTTKTSRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1448

Sequence Alignment: 7. Allergen Name: Sal s 6.0102 Sequence ID: XP_014048044

 Score = 622.5 bits 4858,  Expect = 1e-178
 Identities = 810/1330 60%, Positives = 950/1330 71%, Gaps = 19/1330 1%
Query  26   GLKGPRGAKGPRGDRGPQGPNGRDGKPGLPGVAGPPGPPGLGGNFAAQFDGGKGSDPG-- 83
            G +G RGAKG  G  G  G +G  G+PGLPG  GPPGPPGLGGNF+ Q  GG     G  
Sbjct  100  GPQGDRGAKGEPGAPGFPGNDGIPGQPGLPGPPGPPGPPGLGGNFSPQMSGGFDEKSGGG 159
Query  84   ---PGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQTGAIGARGPPGSAGKPGEDGN 140
               PGPMG MG RGP GPPGS GPQGFTG  GEPGE G +G +G RGP G  GK G+DG 
Sbjct  160  MSMPGPMGPMGPRGPPGPPGSSGPQGFTGPPGEPGEAGSSGPMGPRGPAGPPGKNGDDGE 219
Query  141  NGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGETGAHGA 200
            +G+PG+PG+RG  G QGARGFPGTPGLPG+KGHRG++GLDG KGE+G AG KGE GA G 
Sbjct  220  SGKPGRPGERGASGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGETGPAGPKGEAGASGE 279
Query  201  NGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPAGPLGAAGPPGFPGAPGPKGE 260
            NG  G  G RGL GERGRAGP G AGARG DG+ G AGP GP G AG PGFPG PG KGE
Sbjct  280  NGAAGAMGPRGLPGERGRAGPNGAAGARGNDGAAGAAGPPGPTGPAGAPGFPGGPGAKGE 339
Query  261  IGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGINGAKGAAGLPGVAGAPGFPGP 320
            +G  G+ G  GPQG RGE G  G  G  GP GN G +G  G KGA G  G+AGAPGFPGP
Sbjct  340  VGAQGARGGEGPQGSRGEAGNPGPAGAAGPAGNNGADGNPGTKGAPGSAGIAGAPGFPGP 399
Query  321  RGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHSGVQGPAGPAGEEGKRGSTGE 380
            RG PGPQG  G+ G +G  G+ G +G KG++GAKGE G +GVQGPAGPAGEEGKRGS GE
Sbjct  400  RGPPGPQGAGGAPGPKGNTGEVGATGAKGEAGAKGESGPAGVQGPAGPAGEEGKRGSRGE 459
Query  381  AGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGATGPAGIRGAPGDAGRAGESGL 440
             GA G  G  G RGG G+RG+PG +G  GP G PG RG  G AG +G  G+ GR GE G+
Sbjct  460  PGAAGARGAPGERGGPGSRGFPGADGAAGPKGGPGERGGAGVAGAKGNTGEPGRNGEPGM 519
Query  441  TGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPRGQPGNIGFPGPKGPGGEAGK 500
             G++G+ G+ G  GP GK GPSGA G DGR GPPGP G RGQPG +GFPGPKG  GE GK
Sbjct  520  PGSKGMTGSPGSPGPDGKTGPSGAGGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEGGK 579
Query  501  GGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGPAGPAGE 560
             G++G  G  G  G PG DG+ GAPG  GV G AGE+GEQG  G PGFQGLPGP G  GE
Sbjct  580  PGERGVMGPGGAVGAPGKDGDVGAPGAPGVAGPAGERGEQGAGGPPGFQGLPGPQGAIGE 639
Query  561  AGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGEPGS 620
             GK G QG+PG+ G PG AG +G+RG  G  G+ G  G  GARG  G+ G DG KGE G+
Sbjct  640  TGKPGEQGLPGEGGAPGSAGSRGDRGFPGERGAPGPSGPAGARGSPGSAGNDGAKGEAGA 699
Query  621  VGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGAPGPSGPPGP 680
             G  G  G  G  GMPGERGAGG PG KG++G+ G +G +G  G+DGARG  GP GP GP
Sbjct  700  AGAPGGQGPPGLQGMPGERGAGGLPGLKGDRGDQGVKGADGAGGKDGARGMTGPIGPNGP 759
Query  681  SGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPGFAGPPGSDGQSGPRGEKGPAGG 740
            +G+ G+KGE+G+ G  GP+G RG  GERGE G  GP GFAGPPG DGQ G +GE G  G 
Sbjct  760  AGSPGDKGETGAPGAVGPSGARGAPGERGESGAPGPAGFAGPPGGDGQPGAKGEAGDNGA 819
Query  741  KGDVGPAGPAGPAGQSGPSGASGPAGPPGGRGDAGPSGLTGFPGAAGRVGGPGPAGIAGP 800
            KGD G  GPAGP G  GP G +G  G  G RG AGP G TGFPGAAGRVG PGP+G  GP
Sbjct  820  KGDGGAQGPAGPTGAPGPQGPAGNTGAKGARGAAGPPGATGFPGAAGRVGPPGPSGNNGP 879
Query  801  PGSAGPAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDKGPSGESGPPGPPGTAGPQGV 860
            PG  GP GK+G +G RG+ GP G  GE GA GP G  G+KG  G  GP GP GT GPQG+
Sbjct  880  PGPPGPGGKEGQKGNRGETGPAGRPGELGAAGPPGAQGEKGQPGGDGPNGPSGTPGPQGI 939
Query  861  LGHAGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPRGPSGNIGMPGMTGTQGEAGR 920
             G+ G VGLPG RG++G+PG  G +GEPG+ GP G SG RGP G +G PG+ G  GE GR
Sbjct  940  GGQRGIVGLPGQRGERGFPGLAGQLGEPGKQGPGGPSGERGPPGPMGPPGLAGAPGEPGR 999
Query  921  EGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPNGPAGSAGRPGNRGESGPTGN 980
            EG PGN+G  GR GAAG KG+RGE G  GA G+ G PG  GP G AG+ G+RGESGP G 
Sbjct  1000 EGTPGNEGSSGRDGAAGPKGERGESGVAGASGAPGPPGAPGPVGPAGKSGDRGESGPAGP 1059
Query  981  GGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHGGLQGMPGPNGPSGETGSAGI 1040
             G  G AG RG  GPAG RG+KG AGE G+RGMKG RG  G+QG PGP+G SGE+G AG 
Sbjct  1060 AGIAGPAGPRGPSGPAGARGDKGEAGEAGERGMKGHRGFTGMQGPPGPSGQSGESGPAGA 1119
Query  1041 TGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHLGPAGPPGSPGLPGPAGPAGG 1100
            +GPAGPRGP+G  G  GKDG +G  G IGP G RG  G +GP+GPPG PG PGP GP GG
Sbjct  1120 SGPAGPRGPSGSAGAAGKDGMSGLPGPIGPPGPRGRSGEMGPSGPPGPPGPPGPPGPPGG 1179
Query  1101 GYDQS-----------GGYDEYRADQPS-LRAKDYEVDATIKSLNSQIENLLTPEGSKKN 1148
            G+D               +  +RAD  + +R +D EVD T+KSL+ QIEN+ +PEG+KKN
Sbjct  1180 GFDMGFIAQPAQEKAPDPFRHFRADDANVMRDRDLEVDTTLKSLSQQIENIRSPEGTKKN 1239
Query  1149 PARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYR 1208
            PARTCRD+++ HP+W SG YWIDP+QGC  DAIK YC+  TG TC++P    I +K+WY 
Sbjct  1240 PARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYCNMETGETCVYPIEADIPKKSWYT 1299
Query  1209 SS--ENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSV 1266
            S   + KKHVWFGE +  G +F Y  E  S Q +  QL F+RL+A +A+QNITYHCKNS+
Sbjct  1300 SKNIKEKKHVWFGEAMTDGFQFEYGSEGSSAQDVNIQLTFLRLMATEASQNITYHCKNSI 1359
Query  1267 AYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKP 1326
            AYMD ++GNLKK++LLQGSN++E+RAEGNSRFT++V EDGCT HTG W KTVI+Y+T K 
Sbjct  1360 AYMDQQSGNLKKSLLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKT 1419
Query  1327 SRLPILDIAPLDIGEADQEFGLDIGPVCF 1355
            SRLPI+DIAP+D+G  +QEFG+++GPVCF
Sbjct  1420 SRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1448

Sequence Alignment: 8. Allergen Name: Tri a glutenin Sequence ID: CAA27052

 Score = 83.7 bits 560,  Expect = 1e-16
 Identities = 203/673 30%, Positives = 279/673 41%, Gaps = 85/673 12%
Query  30   PRGAKGPRGDRGP-QGPNGRD--GKPGL-----PGVAGPPGPPGLGGNFAAQFDGGKGSD 81
            P+G     G+  P Q    R   G P L     P V  P       G  + Q  G +G  
Sbjct  80   PKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPG-QGQQ 138
Query  82   PGPGPMGLMGSRG--PNGP--PGS-PGP-QGFTGH-AGEPGEPGQTGAIGARGPPGSAGK 134
            PG G     G +G  P  P  PG    P QG  G+    P +PGQ         PG  G+
Sbjct  139  PGQGQQSGQGQQGYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQ-GQ 197
Query  135  PGEDGNNGRPG--------KPGDRGGP--GTQGARGFPGTPGLPGMKGHRGYNGLDGRKG 184
             G     G+PG        +PG    P  G QG +   G  G    +G++   G  G++ 
Sbjct  198  QGRQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQQGQQP 257
Query  185  ESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTG--PAGPAGP 242
              G    +G+ G +   G  G   +      +G+ G    +  +   G +G  P  P  P
Sbjct  258  GQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQP 317
Query  243  LGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGINGA 302
             G    PG    P      G     G  G Q G+G+ G     G     G PG    +  
Sbjct  318  -GQGQQPGQLQQPAQ----GQQPEQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQ 372
Query  303  KGAAGLPGVAGAPGF-PGPRGGPGPQGPQGSTGARGLGGD-PGPSGQKGDSGAKGEPGHS 360
            +   G PG        P     PG QG QG    +G     PG   Q G    +G+PG+ 
Sbjct  373  QSGQGQPGYYPTSSQQPTQSQQPG-QGQQGQQVGQGQQAQQPGQGQQPG----QGQPGYY 427
Query  361  GVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT 420
                P  P   +  +G  G    +     +G + G   +   G +G+    G    +G  
Sbjct  428  ----PTSPL--QSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQ 481
Query  421  GPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGP- 479
            G    +G  G     G+ G       P  SGQG  PG+    G  G  G   P  P  P 
Sbjct  482  GQQPGQGQQGQQPGQGQPGYYPTS--PQQSGQGQQPGQWQQPGQ-GQPGYY-PTSPLQPG 537
Query  480  RGQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVV-GNAGEKG 538
            +GQPG      P+ PG     G  + P  A G +G   A G  G   PA V  G    +G
Sbjct  538  QGQPG-YDPTSPQQPGQGQQPGQLQQP--AQGQQGQQLAQGQQGQQ-PAQVQQGQQPAQG 593
Query  539  EQGPSGAPGFQGL-PGPAG-PA-GEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAG 595
            +QG     G QG  PG    PA G+ G+   QG  G Q  PG     G+ G      ++ 
Sbjct  594  QQGQQLGQGQQGQQPGQGQQPAQGQQGQQPGQGQQGQQ--PGQGQQPGQ-GQPWYYPTSP 650
Query  596  SQGAIGAR-GPAGTPGP--DGGKGEPG---SVGIVGAAGHQG--PGGMPGERGAGGTPGP 647
             +   G + G    PG     G+G+PG   +  +    G+QG  P  +  + G G  PG 
Sbjct  651  QESGQGQQPGQWQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQ-QPGQGQQPGQ 709
Query  648  KGEKGEGGHRGLEGNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGE 707
              + G+G H     +    G    PG    PG       +G+ G + P  P      SG+
Sbjct  710  WQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPG-------QGQQGYY-PTSPQ----QSGQ 757
Query  708  RGEGGPAGPPGFAGPPGSDGQSGPRGEKGPAGGKGDVG 745
              + G    PG  G  G    S  +  +G   G+G  G
Sbjct  758  GQQLGQWLQPG-QGQQGYYPTSLQQTGQGQQSGQGQQG 794

Sequence Alignment: 9. Allergen Name: Tri a glutenin Sequence ID: CAA31395

 Score = 80.1 bits 531,  Expect = 1e-15
 Identities = 198/673 29%, Positives = 277/673 41%, Gaps = 76/673 11%
Query  30   PRGAKGPRGDRGP-QGPNGRD--GKPGL-----PGVAGPPGPPGLGGNFAAQFDGGKGSD 81
            P+G     G+  P Q    R   G P L     P V  P       G  + Q  G +G  
Sbjct  81   PKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPG-QGQQ 139
Query  82   PGPGPMGLMGSRGPNGPPGSPGP-QGFTGH-AGEPGEPGQTGAIGARGPPGSAGKPGEDG 139
            PG G  G   +  P  P     P QG  G+    P +PGQ         PG  G+ G+  
Sbjct  140  PGQGQQGYYPT-SPQQPGQWQQPEQGQQGYYPTSPQQPGQLQQPAQGQQPGQ-GQQGQQP 197
Query  140  NNGRPG--------KPGDRGGP--GTQGARGFPGTPGL-PGMKGHRGYNGLDGRKGESGT 188
              G+PG        +PG    P  G QG +      G  PG +G++   G  G++   G 
Sbjct  198  GQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPG-QGQQPGQGQQGQQPGQGQ 256
Query  189  AGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTG--PAGPAGPLGAA 246
               +G+ G +   G  G   +      +G+ G    +  +   G +G  P  P  P G  
Sbjct  257  QPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQP-GQG 315
Query  247  GPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGINGAKGAA 306
              PG    P  +G+  G    G  G Q G+G+ G     G     G PG    +  +   
Sbjct  316  QQPGQLQQPA-QGQQPG---QGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQ 371
Query  307  GLPGVAGAPGF-PGPRGGPGPQGPQGSTGARGLGGD-PGPSGQKGDSGAKGEPGHSGVQG 364
            G PG        P     PG QG QG    +G     PG   Q G    +G+PG+     
Sbjct  372  GQPGYYPTSSQQPTQSQQPG-QGQQGQQVGQGQQAQQPGQGQQPG----QGQPGYY---- 422
Query  365  PAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGATGPAG 424
            P  P  ++  +G  G    +     +G + G   +   G +G+    G    +G  G   
Sbjct  423  PTSP--QQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQP 480
Query  425  IRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGP-RGQP 483
             +G  G     G+ G       P  SGQG  PG+    G  G  G   P  P  P +GQP
Sbjct  481  GQGQQGQQPGQGQPGYYPTS--PQQSGQGQQPGQWQQPGQ-GQPGYY-PTSPLQPGQGQP 536
Query  484  GNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVV-GNAGEKGEQGP 542
            G      P+ PG     G  + P  A G +G   A G  G   PA V  G    +G+QG 
Sbjct  537  G-YDPTSPQQPGQGQQPGQLQQP--AQGQQGQQLAQGQQGQQ-PAQVQQGQQPAQGQQGQ 592
Query  543  SGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQG---- 598
                G QG     G  G+    G QG    QG  G    +G++G     G    QG    
Sbjct  593  QLGQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQPWY 652
Query  599  ---AIGARGPAGTPGP--DGGKGEPG---SVGIVGAAGHQG--PGGMPGERGAGGTPGPK 648
               +    G    PG     G+G+PG   +  +    G+QG  P  +  + G G  PG  
Sbjct  653  YPTSPQESGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQ-QPGQGQQPGQW 711
Query  649  GEKGEGGHRGLEGNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLR-GPSGE 707
             + G+G H     +    G    PG    PG     G++G   +     P G + G   +
Sbjct  712  QQSGQGQHWYYPTSPKLSGQGQRPGQWLQPG----QGQQGYYPTSPQQPPQGQQLGQWLQ 767
Query  708  RGEGGPAGPPGFAGPPGSDGQSGPRGEKG 736
             G+G     P      G   QSG +G++G
Sbjct  768  PGQGQQGYYPTSLQQTGQGQQSG-QGQQG 795

Sequence Alignment: 10. Allergen Name: Tri a 26.0101 Sequence ID: P10388

 Score = 79.9 bits 530,  Expect = 2e-15
 Identities = 200/668 29%, Positives = 279/668 41%, Gaps = 86/668 12%
Query  30   PRGAKGPRGDRGP-QGPNGRD--GKPGL-----PGVAGPPGPPGLGGNFAAQFDGGKGSD 81
            P+G     G+  P Q    R   G P L     P V  P       G  + Q  G +G  
Sbjct  81   PKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPG-QGQQ 139
Query  82   PGPGPMGLMGSRGPNGP--PGS---P--GPQGFTGHAGEPGEPGQTGAIGARGPPGSAGK 134
            PG G  G      P  P  PG    P  G QG+  +   P +PGQ         PG  G+
Sbjct  140  PGQGQQGYY----PTSPQQPGQWEEPEQGQQGY--YPTSPQQPGQLQQPAQGQQPGQ-GQ 192
Query  135  PGEDGNNGRPG--------KPGDRGGP--GTQGARGFPGTPGL-PGMKGHRGYNGLDGRK 183
             G+    G+PG        +PG    P  G QG +      G  PG +G++   G  G++
Sbjct  193  QGQQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPG-QGQQPGQGQQGQQ 251
Query  184  GESGTAGAKGETGAHGANGNPGPAGSRGLNGERGRAGPAGPAGARGADGSTG--PAGPAG 241
               G    +G+ G +   G  G   +      +G+ G    +  +   G +G  P  P  
Sbjct  252  PGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQ 311
Query  242  PLGAAGPPGFPGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGING 301
            P G    PG    P  +G+  G    G  G Q G+G+ G     G     G PG    + 
Sbjct  312  P-GQGQQPGQLQQPA-QGQQPG---QGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSP 366
Query  302  AKGAAGLPGVAGAPGF-PGPRGGPGPQGPQGSTGARGLGGD-PGPSGQKGDSGAKGEPGH 359
             +   G PG        P     PG QG QG    +G     PG   Q G    +G+PG+
Sbjct  367  QQSGQGQPGYYPTSSQQPTQSQQPG-QGQQGQQVGQGQQAQQPGQGQQPG----QGQPGY 421
Query  360  SGVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGA 419
                 P  P  ++  +G  G    +     +G + G   +   G +G+    G    +G 
Sbjct  422  Y----PTSP--QQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQ 475
Query  420  TGPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGP 479
             G    +G  G     G+ G       P  SGQG  PG+    G  G  G   P  P  P
Sbjct  476  QGQQPGQGQQGQQPGQGQPGYYPTS--PQQSGQGQQPGQWQQPGQ-GQPGYY-PTSPLQP 531
Query  480  -RGQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVV-GNAGEK 537
             +GQPG      P+ PG     G  + P  A G +G   A G  G   PA V  G    +
Sbjct  532  GQGQPG-YDPTSPQQPGQGQQPGQLQQP--AQGQQGQQLAQGQQGQQ-PAQVQQGQQPAQ 587
Query  538  GEQGPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQ 597
            G+QG     G QG     G  G+    G QG    QG  G    +G++G     G    Q
Sbjct  588  GQQGQQLGQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQ 647
Query  598  G-------AIGARGPAGTPGP--DGGKGEPG---SVGIVGAAGHQG--PGGMPGERGAGG 643
            G       +    G    PG     G+G+PG   +  +    G+QG  P  +  + G G 
Sbjct  648  GQPWYYPTSPQESGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQ-QPGQGQ 706
Query  644  TPGPKGEKGEGGHRGLEGNMGRDGARGAPGPSGPPGPSGANGEKGESGSFGPAGPAGLR- 702
             PG   + G+G H     +    G    PG    PG     G++G   +     P G + 
Sbjct  707  QPGQWQQSGQGQHWYYPTSPKLSGQGQRPGQWLQPG----QGQQGYYPTSPQQPPQGQQL 762
Query  703  GPSGERGEGGPAGPPGFAGPPGSDGQSGPRGEKG 736
            G   + G+G     P      G   QSG +G++G
Sbjct  763  GQWLQPGQGQQGYYPTSLQQTGQGQQSG-QGQQG 795

Sequence Alignment: 11. Allergen Name: Tri a glutenin Sequence ID: CAA43331

 Score = 67.3 bits 429,  Expect = 1e-11
 Identities = 176/619 28%, Positives = 257/619 41%, Gaps = 81/619 13%
Query  55   PGVAGPPGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEP 114
            PG    PG       + +    G+   PG G  G          P SP   G       P
Sbjct  131  PGQGQQPGQGQQEYYLTSPQQSGQWQQPGQGQAGYY--------PTSPQQSGQEQPGYYP 182
Query  115  GEPGQTGAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGH- 173
              P Q   +          +PG+ G   R G+ G + G G    R +P +   PG   + 
Sbjct  183  TSPWQPEQLQQPTQGQQRQQPGQ-GQQLRQGQQGQQSGQGQP--RYYPTSSQQPGQLQQL 239
Query  174  -RGYNGLDGRKGESGTAGAKGETGAHGANGN-PGPAGSRGLNGERGRAGPAGPAG-ARGA 230
             +G  G    +G+ G    +G+   +G  G  PG     G  G++G   P  P    +G 
Sbjct  240  AQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSG-QGQQGYY-PISPQQLGQGQ 297
Query  231  DGSTGPAG--PAGPLGAA-GPPGF-PGAPGPKGEIGGVGSNGPSGPQGGRGEPGINGAVG 286
                G  G  P  P  +  G  G+ P +    G++         G +    + G  G  G
Sbjct  298  QSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQSG-QGRQG 356
Query  287  PVGPVGNPGNNGINGAKGAAGLPGV-AGAP---GFPGPRGGP-GPQGPQGSTGARGLGG- 340
                          G +     PG  + +P   G   PR  P  PQ P      R L   
Sbjct  357  QQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQP 416
Query  341  DPGPSGQKGDSGAKGE-PGHSGVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTR 399
            + G  GQ+ + G +G+ PG+ G QG     G++G++   G+ G    +  +  +G  G  
Sbjct  417  EQGQQGQQPEQGQQGQQPGQ-GEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGY- 474
Query  400  GLPGLEGRGGPIGMPGARGATGPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKE 459
              P    + G +  P      G       PG  G+ G+    G +  PG    G  P   
Sbjct  475  -YPTSPQQSGQLQQPAQGQQPGQEQQGQQPGQ-GQQGQQPGQGQQ--PGQGQPGYYPTSP 530
Query  460  GPSGAAGL-----DGRTGPPG--PTGPRGQPGNIGFPG--PKGPGGEAGKGGDKG----P 506
              SG             G PG  PT P  QPG  G PG  P  P  + G+G   G    P
Sbjct  531  QQSGQEQQLEQWQQSGQGQPGHYPTSPL-QPGQ-GQPGYYPTSPQ-QIGQGQQPGQLQQP 587
Query  507  T-GATGLRGGPGADGNNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGPAGPAGEAGKAG 565
            T G  G + G G  G    PG  G  G    +G+Q   G PG+   P     +G+  + G
Sbjct  588  TQGQQGQQPGQGQQGQQ--PGQ-GQQGQQPGQGQQPGQGQPGY--YPTSLQQSGQGQQPG 642
Query  566  NQGMPGDQGLPG--P-AGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGEPGSVG 622
                PG QGLPG  P + ++ E+G  G   ++  Q     +GP        G+G+ G   
Sbjct  643  QWQQPG-QGLPGYYPTSSLQPEQGQQGYYPTSQQQPG---QGPQPGQWQQSGQGQQGYYP 698
Query  623  IVGAAGHQG--PGG--MPGERGAGG----TPGPKGEKGEGGHRGLEGNMGRDGARG-APG 673
                   QG  PG    PG+    G    +P   G+ G+   + L+   G+ G    +P 
Sbjct  699  TSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQ-GQQPRQWLQPRQGQQGYYPTSPQ 757
Query  674  PSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGP 713
             SG  G     G++G    + P  P   +   G++G   P
Sbjct  758  QSGQ-GQQLGQGQQG----YYPTSPQ--QSGQGQQGYDSP 790

Sequence Alignment: 12. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 63.9 bits 402,  Expect = 1e-10
 Identities = 171/620 27%, Positives = 253/620 40%, Gaps = 72/620 11%
Query  55   PGVAGPPGPPGLGGN---FAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHA 111
            PG A    P G G     + +    G+   PG G  G          P SP   G     
Sbjct  123  PGQASSQRP-GQGQQEYYLTSPQQSGQWQQPGQGQSGYY--------PTSPQQSGQKQPG 173
Query  112  GEPGEPGQTGAIGARGPPGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMK 171
              P  P Q   +          +PG+ G   R G+ G + G G    R +P +   PG  
Sbjct  174  YYPTSPWQPEQLQQPTQGQQRQQPGQ-GQQLRQGQQGQQSGQGQP--RYYPTSSQQPGQL 230
Query  172  GH--RGYNGLDGRKGESGTAGAKGETGAHGANGN-PGPAGSRGLNGERGRAGPAGPAG-A 227
             +  +G  G    +G+ G    +G+   +G  G  PG     G  G++G   P  P    
Sbjct  231  QQLAQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSG-QGQQGYY-PISPQQLG 288
Query  228  RGADGSTGPAG--PAGPLGAA-GPPGF-PGAPGPKGEIGGVGSNGPSGPQGGRGEPGING 283
            +G     G  G  P  P  +  G  G+ P +    G++         G +    + G  G
Sbjct  289  QGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQSG-QG 347
Query  284  AVGPVGPVGNPGNNGINGAKGAAGLPGV-AGAP---GFPGPRGGP-GPQGPQGSTGARGL 338
              G              G +     PG  + +P   G   PR  P  PQ P      R L
Sbjct  348  RQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQL 407
Query  339  GG-DPGPSGQKGDSGAKGEPGHSGVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAG 397
               + G  GQ+ + G +G+    G QG     G++G++   G+ G    +  +  +G  G
Sbjct  408  QQPEQGQQGQQPEQGQQGQQQRQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPG 467
Query  398  TRGLPGLEGRGGPIGMPGARGATGPAGIRGAPGDAGRAGESGLTGARGL-PGNSGQGGPP 456
                P    + G +  P      G       PG   + G+ G  G     P  SGQ    
Sbjct  468  Y--YPTSPQQSGQLQQPAQGQQPGQEQQGQQPGQGQQPGQ-GQPGYYPTSPQQSGQEQQL 524
Query  457  GKEGPSGAAGLDGRTGPPGPTGP-RGQPGNIGFP-GPKGPGGEAGKGGDKGPT-GATGLR 513
             +   SG  G  G   P  P  P +GQPG   +P  P+  G     G  + PT G  G +
Sbjct  525  EQWQQSGQ-GQPGHY-PTSPLQPGQGQPGY--YPTSPQQIGQGQQPGQLQQPTQGQQGQQ 580
Query  514  GGPGADGNNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQ 573
             G G  G    PG  G  G    +G+Q   G PG+   P     +G+  + G    PG Q
Sbjct  581  PGQGQQGQQ--PGE-GQQGQQPGQGQQPGQGQPGY--YPTSLQQSGQGQQPGQWQQPG-Q 634
Query  574  GLPG--P-AGVKGERGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGEPGSVGIVGAAGHQ 630
            G PG  P + ++ E+G  G   ++  Q     +GP        G+G+ G          Q
Sbjct  635  GQPGYYPTSSLQPEQGQQGYYPTSQQQPG---QGPQPGQWQQSGQGQQGYYPTSPQQSGQ 691
Query  631  G--PGG--MPGERGAGG----TPGPKGEKGEGGHRGLEGNMGRDGARG-APGPSGPPGPS 681
            G  PG    PG+    G    +P   G+ G+   + L+   G+ G    +P  SG  G  
Sbjct  692  GQQPGQWLQPGQWLQSGYYLTSPQQLGQ-GQQPRQWLQPRQGQQGYYPTSPQQSGQ-GQQ 749
Query  682  GANGEKGESGSFGPAGPAGLRGPSGERGEGGP 713
               G++G    + P  P   +   G++G   P
Sbjct  750  LGQGQQG----YYPTSPQ--QSGQGQQGYDSP 775

Sequence Alignment: 13. Allergen Name: Tri a glutenin Sequence ID: CAA43361

 Score = 60.6 bits 376,  Expect = 9e-10
 Identities = 155/500 31%, Positives = 221/500 44%, Gaps = 81/500 16%
Query  233  STGPAGPAGPLGAAGP--PGFPGAPGPKGEIGGVGSNG--PSG-PQGGRGEPGINGAVGP 287
            S+   GP  P G A P  PG    PG   E+G  G  G  P+   Q G+G+ G      P
Sbjct  132  SSPQQGPYYP-GQASPQQPGQGQQPGKWQELGQ-GQQGYYPTSLHQSGQGQQGYY----P 185
Query  288  VGPVGNPGNNGINGAKGAAGL-PGVAGAPGFPGPRGGPGPQGPQGSTGAR-GLGGDPGPS 345
               +  PG  G    +G  G  P     PG  G + G G QG   ++    G    PG  
Sbjct  186  -SSLQQPGQ-GQQIGQGQQGYYPTSLQQPG-QGQQIGQGQQGYYPTSPQHPGQRQQPGQG 242
Query  346  GQKGDSGAKGEPGHSGVQGPAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGL-PGL 404
             Q G     G+  + G QG     G++G   ++ +    G    +  + G G +G  P  
Sbjct  243  QQIGQGQQLGQGRQIG-QGQQSGQGQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGYYPTS 301
Query  405  EGRGGPIGMPGARGATGPAGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGA 464
            + + G  G  G   A+     +  PG  G+ G+     ++  PG   QG  P  +   G 
Sbjct  302  QQQPGQ-GQQGQYPAS-----QQQPGQ-GQQGQ--YPASQQQPGQGQQGQYPASQQQPGQ 352
Query  465  AGLDGR----TGPPGPTGPRGQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADG 520
             G  G        PG    R  P ++  PG           G +G   A+  + G G  G
Sbjct  353  -GQQGHYLASQQQPGQGQQRHYPASLQQPGQ----------GQQGHYTASLQQPGQGQQG 401
Query  521  NNGAPGPAGVVGNAGEKGEQGPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAG 580
            +   P     VG   + G+ G    PG QG     G   E G+   QG    QG     G
Sbjct  402  HY--PASLQQVGQGQQIGQLGQRQQPG-QGQQTRQGQQLEQGQQPGQGQQTRQGQQLEQG 458
Query  581  VKGERGNSGPAGSAGSQGAIGAR-GPAGTPGPDGGKG-------EPGSVGIVG--AAGHQ 630
             +  +G  G   ++  Q   G + G +  PG  G +G       +PG  G+ G   A  Q
Sbjct  459  QQPGQGQQGYYPTSPQQSGQGQQPGQSQQPG-QGQQGYYSSSLQQPGQ-GLQGHYPASLQ 516
Query  631  GPG-GMPGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGAPGPSGPPGPS-GANGEKG 688
             PG G PG+R     PG +G++ E G++  +G  G         P+ P  P  G    +G
Sbjct  517  QPGQGHPGQRQQ---PG-QGQQPEQGQQPGQGQQGYY-------PTSPQQPGQGKQLGQG 565
Query  689  ESGSF--GPAGPAGLRGPS-GERGEGGPAGPP--GFAGPPGSDGQSGPRGEKGPAGGKGD 743
            + G +   P  P   + P  G++G   P  P   G A  PG   Q G   +  P  G+  
Sbjct  566  QQGYYPTSPQQPGQGQQPGQGQQGHC-PTSPQQTGQAQQPGQGQQIGQVQQ--PGQGQQG 622
Query  744  VGPAG--PAGPAGQSGPSGASGPAGPPGGRGDAGPSGLTGF 782
              P     +G   QSG    SG  G   G+G        G+
Sbjct  623  YYPISLQQSGQGQQSGQGQQSGQ-GHQLGQGQQSGQEQQGY 662

Sequence Alignment: 14. Allergen Name: Tri a glutenin Sequence ID: CAA26847

 Score = 54.1 bits 324,  Expect = 8e-08
 Identities = 148/502 29%, Positives = 207/502 41%, Gaps = 55/502 10%
Query  479  PRGQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADG-NNGAPGPAGVVGNAGEK 537
            P+G  G+  +PG   P  +  +G   G +  T     P       G+  P    G A  +
Sbjct  95   PKG--GSF-YPGETTPLQQLQQGIFWGTSSQTVQGYYPSVTSPRQGSYYP----GQASPQ 147
Query  538  GEQGPSGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQ 597
             + G    PG    PG  G       +  Q  PG QG     G +G    S      G Q
Sbjct  148  -QPGQGQQPGKWQEPGQ-GQQWYYPTSLQQ--PG-QGQQIGKGKQGYYPTSLQQPGQGQQ 202
Query  598  GAIGARGPAGT-PGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGH 656
               G +G   T P   G + +P     +G   +   G  PG+   G  P    + G+G +
Sbjct  203  IGQGQQGYYPTSPQHTGQRQQPVQGQQIGQGQQPEQGQQPGQWQQGYYPTSPQQLGQGQQ 262
Query  657  RGLEGNMGRDGARGA-PGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGER-GEGGPA 714
             G     G+ G +G  P     PG  G  G    S      G  G    S ++ G+G   
Sbjct  263  PGQWQQSGQ-GQQGHYPTSLQQPG-QGQQGHYLASQQQPAQGQQGHYPASQQQPGQGQQG 320
Query  715  GPPGFAGPPGSDGQSG--PRGEKGPAGGKGDVGPAGPAGPA-GQSGPSGASGPAGPPGGR 771
              P     PG  GQ G  P  ++ P  G+    PA    P  GQ G   AS     PG +
Sbjct  321  HYPASQQQPGQ-GQQGHYPASQQEPGQGQQGQIPASQQQPGQGQQGHYPAS--LQQPGQQ 377
Query  772  GDAGPSGLTGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEPGAV 831
            G   P+ L  + G   ++G PG       PG     G+         PG G     P ++
Sbjct  378  GHY-PTSLQQL-GQGQQIGQPGQKQ---QPGQGQQTGQGQQPEQEQQPGQGQQGYYPTSL 432
Query  832  GPAGITGDKGPSGESGPPGPPGTAGP-QGVLGH-AGFVGLPGSRGDKGLPG-----GPGA 884
               G  G +   G+ G   P     P QG  GH    +  PG +G +G PG     G G 
Sbjct  433  QQPG-QGQQQGQGQQGYY-PTSLQQPGQGQQGHYPASLQQPG-QG-QGQPGQRQQPGQGQ 488
Query  885  VGEPGRLGPAGASG--PRGPSGNIGMPGMTGTQGEAGREGN-PGNDGPPGRPGAAGFKGD 941
              E G+    G  G  P  P      PG  G Q   G++G  P +   PG+    G +G 
Sbjct  489  HPEQGQQPGQGQQGYYPTSPQ----QPGQ-GQQLGQGQQGYYPTSPQQPGQGQQPG-QGQ 542
Query  942  RGE-PGSPGALGSSGQPGPNGPAGSAGRPGNRGESG--PTGNGGPVGAAGARGAPGPAGP 998
            +G  P SP   G + Q G     G   +PG +G+ G  PT    P    G +   G    
Sbjct  543  QGHCPMSPQQTGQAQQLGQGQQIGQVQQPG-QGQQGYYPTSLQQP--GQGQQSGQGQQSG 599
Query  999  RGEKGGAGEKGDRGMKG 1015
            +G + G G++  +  +G
Sbjct  600  QGHQPGQGQQSGQEKQG 616

Sequence Alignment: 15. Allergen Name: Tri a glutenin Sequence ID: CAA31396

 Score = 41.6 bits 225,  Expect = 0.0004
 Identities = 139/458 30%, Positives = 192/458 41%, Gaps = 62/458 13%
Query  529  GVVGNAGEKGEQG--PSGAPGFQG--LPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGE 584
            G+      +  QG  P      QG   PG A P  + G+ G Q  PG    PG  G +  
Sbjct  114  GIFWGTSSQTVQGYYPGVTSPRQGSYYPGQASPQ-QPGQ-GQQ--PGKWQEPGQ-GQQWY 168
Query  585  RGNSGPAGSAGSQGAIGARGPAGTPGPDGGKGE----PGSVGIVG-----AAGHQGPGGM 635
               S      G Q   G +G   T     G+G+    P S+   G       G+Q   G 
Sbjct  169  YPTSLQQPGQGQQIGKGQQGYYPTSLQQPGQGQQGYYPTSLQHTGQRQQPVQGQQPEQGQ 228
Query  636  -PGERGAGGTPGPKGEKGEGGHRGLEGNMGRDGARGA-PGPSGPPGPSGANGEKGESGSF 693
             PG+   G  P    + G+G ++  +      G +G  P     PG  G  G    S   
Sbjct  229  QPGQWQQGYYPTSPQQLGQG-QQPRQWQQSGQGQQGHYPTSLQQPG-QGQQGHYLASQQQ 286
Query  694  GPAGPAGLRGPSGER-GEGGPAGPPGFAGPPGSDGQSG--PRGEKGPAGGKGDVGPAGPA 750
               G  G    S ++ G+G     P     PG  GQ G  P  ++ P  G+    PA   
Sbjct  287  PGQGQQGHYPASQQQPGQGQQGHYPASQQQPGQ-GQQGHYPASQQEPGQGQQGQIPASQQ 345
Query  751  GPA-GQSG--PSGASGPAGPPGGRGDAG--PSGLTGFPGAAGRVGGPGPAGIAGPPGSAG 805
             P  GQ G  P+    P     G+G  G  P+ L  + G   + G PG       PG   
Sbjct  346  QPGQGQQGHYPASLQQP-----GQGQQGHYPTSLQQL-GQGQQTGQPGQ---KQQPGQGQ 396
Query  806  PAGKDGPRGLRGDPGPGGPQGEPGAVGPAGITGDKGPSGESGPPGPPGTAGP-QGVLGH- 863
              G+         PG G     P ++   G  G +   G+ G   P     P QG  GH 
Sbjct  397  QTGQGQQPEQEQQPGQGQQGYYPTSLQQPG-QGQQQGQGQQGYY-PTSLQQPGQGQQGHY 454
Query  864  AGFVGLPGSRGDKGLPGGPGAVGEP--GRLGPAGASG--PRGPSGNIGMPGMTGTQGEAG 919
               +  PG +G  G    PG    P  G+    G  G  P  P      PG  G Q   G
Sbjct  455  PASLQQPG-QGQPGQRQQPGQGQHPEQGKQPGQGQQGYYPTSPQ----QPGQ-GQQLGQG 508
Query  920  REGN-PGNDGPPGRPGAAGFKGDRGE-PGSPGALGSSGQPGPNGPAGSAGRPGNRGESG- 976
            ++G  P +   PG+    G +G +G  P SP   G + QPG     G   +PG +G+ G 
Sbjct  509  QQGYYPTSPQQPGQGQQPG-QGQQGHCPTSPQQSGQAQQPGQGQQIGQVQQPG-QGQQGY 566
Query  977  -PTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKG 1015
             PT    P    G +   G    +G + G G++  +  +G
Sbjct  567  YPTSVQQP--GQGQQSGQGQQSGQGHQPGQGQQSGQEQQG 604

Sequence Alignment: 16. Allergen Name: Par h 1.0101 Sequence ID: A0A0X9C7K4

 Score = 36.2 bits 185,  Expect = 0.004
 Identities = 36/66 54%, Positives = 37/66 56%, Gaps = 11/66 16%
Query  474  PGPTGPRGQPGNIGFPGPKGPGGEAGK----GGDKGPTGATGLRGGPGADGNNGAPGPAG 529
            PGP  P G PG  G P P  PGG  G     GG   P G  G  GG G +G  GAP PAG
Sbjct  84   PGP--PPGAPGTPGTP-PAPPGGGEGDAPPGGGAPPPAGGEG--GGGGGEGGGGAPPPAG 138
Query  530  VVGNAGEKGEQGPSGAP 546
              G  G  G  G  GAP
Sbjct  139  --GEGGGGGGDGGGGAP 153

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.