The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL
HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL
DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY
NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND
IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA
LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV
YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA
Sequence Info Allergen Name Length Opt Bits Score E Value
P28296 Asp f 13 403 2568 591.7 2e-170
CAA35594 Asp o 13 403 2146 495.5 1.8e-141
AAD47202 Asp fl protease 403 2141 494.4 3.9e-141
ADE74975 Asp v 13.0101 403 2050 473.6 6.9e-135
AAD52013 Tri r 2.0101 412 970 227.5 9.1e-61
AAD25926 Pen c 13.0101 397 955 224.1 9.3e-60
AAF23726 Pen ch 13 397 949 222.7 2.4e-59
Q32ZM1 Rho m 2.0101 342 701 166.2 2.1e-42
AAF71379 Pen ch 18 494 695 164.7 8.3e-42
A0A0F6N3V8 Alt a 15.0101 507 453 109.6 3.5e-25
ACF19589 Cur l 4.0101 506 444 107.5 1.4e-24
ABQ59329 Cla c 9.0101 388 441 106.9 1.7e-24
AAX14379 Cla h 9.0101 518 441 106.8 2.4e-24
AAG44478 Pen o 18 503 433 105.0 8.1e-24
Y13338 Asp f 18.0101 495 413 100.5 1.9e-22
A0A0U1Y1N5 Fus p 9.0101 386 406 98.9 4.2e-22
BAA06905 Cuc m 1 731 146 39.5 0.00061
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asp f 13 Sequence ID: P28296

 Score = 591.7 bits 2568,  Expect = 2e-170
 Identities = 403/403 100%, Positives = 403/403 100%, Gaps = 0/403 0%
Query  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
            MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL
Sbjct  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
Query  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
            HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL
Sbjct  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
Query  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
            DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY
Sbjct  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
Query  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
            NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND
Sbjct  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
Query  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
            IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA
Sbjct  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
Query  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
            LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV
Sbjct  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
Query  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA 403
            YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA
Sbjct  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA 403

Sequence Alignment: 2. Allergen Name: Asp o 13 Sequence ID: CAA35594

 Score = 495.5 bits 2146,  Expect = 2e-141
 Identities = 330/403 81%, Positives = 362/403 89%, Gaps = 0/403 0%
Query  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
            M SIKRTLLLLGA+LPAV+GAPVQETRRAA+K+PGKYIVTFKPG D A I+ HT WAT++
Sbjct  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
Query  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
            H+R+LERR  T G+ PVGIE++YKI  FAAYAGSFDDATIEEIRK  DVA+VEEDQI+YL
Sbjct  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
Query  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
            D LTTQK APWGLGSISHKGQ STDYIYDTSAG GTYAYVVDSG+NV+H EFE RAS AY
Sbjct  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
Query  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
            NAAGG HVDSIGHGTHV+GTI GKTYG+AKK ++LSVKVFQGESSSTS+ILDGFNWA ND
Sbjct  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
Query  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
            IVSK RT KAAINMSLGGGYS AFN+AVENAF++GVLSVVAAGNENSDA  TSPASAP+A
Sbjct  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
Query  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
            +TVAAI KSN RASFSN+G VVD+FAPGQDILSAWIGS++ATNTISGTSMATPHIVGLS+
Sbjct  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
Query  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA 403
            YL  LENL GPAAVT RIKELAT  VV +VKGSPN LAYNGNA
Sbjct  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA 403

Sequence Alignment: 3. Allergen Name: Asp fl protease Sequence ID: AAD47202

 Score = 494.4 bits 2141,  Expect = 4e-141
 Identities = 329/403 81%, Positives = 362/403 89%, Gaps = 0/403 0%
Query  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
            M SIKRTLLLLGA+LPAV+GAPVQETRRAA+K+PGKYIVTFKPG D A I+ HT WAT++
Sbjct  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
Query  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
            H+R+LERR  T G+ PVGIE++YKI  FAAYAGSFDDATIEEIRK  DVA+VEEDQI+YL
Sbjct  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
Query  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
            D LTTQK APWGLGSISHKGQ STDYIYDTSAG GTYAYVVDSG+NV+H EFE RAS AY
Sbjct  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
Query  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
            NAAGG HVDSIGHGTHV+GTI GKTYG+AKK ++LSVKVFQGESSSTS+ILDGFNWA ND
Sbjct  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
Query  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
            IVSK RT KAAINMSLGGGYS AFN+AVENAF++GVLSVVAAGNENSDA  TSPASAP+A
Sbjct  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
Query  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
            +TVAAI KSN RASFSN+G VVD+FAPGQDILSAWIGS++ATNTISGTSMATPHIVGLS+
Sbjct  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
Query  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA 403
            YL  LENL GPAAVT RI+ELAT  VV +VKGSPN LAYNGNA
Sbjct  361  YLAALENLDGPAAVTKRIEELATKDVVKDVKGSPNLLAYNGNA 403

Sequence Alignment: 4. Allergen Name: Asp v 13.0101 Sequence ID: ADE74975

 Score = 473.6 bits 2050,  Expect = 7e-135
 Identities = 312/401 77%, Positives = 349/401 87%, Gaps = 0/401 0%
Query  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
            M SIKRT+LLLGA+LPAVFGAP+ E RR  +K+PGKYIVTFK G     I++HT WA+++
Sbjct  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
Query  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
            HKRNLERRD T  +   GIEK++KI  FAAY GSFDDATIEEIR   DVAHVEEDQ+WYL
Sbjct  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
Query  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
            DALTTQ  APWGLG+ISH+G AS+DYIYDTSAGA TYAYVVD+GINV+H EF+ RASLAY
Sbjct  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
Query  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
            NAAGG HVDS+GHGTHVAGTIGGKT+GV+KK NLLSVKVF+GESSSTSIILDG+NWA ND
Sbjct  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
Query  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
            IVSK RT K+AIN+SLGGGYSYAF+NAVE+AFDEGVLSVVAAGNEN DASNTSPASAPNA
Sbjct  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
Query  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
            LTVAA  + NARASFSNYG VVDIFAPG+DILSAWIG  +ATNTISGTSMATPHIVGLS+
Sbjct  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
Query  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNG 401
            YL+ LE LS P  VT+RIKELAT G ++ V GSPN LAYNG
Sbjct  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNG 401

Sequence Alignment: 5. Allergen Name: Tri r 2.0101 Sequence ID: AAD52013

 Score = 227.5 bits 970,  Expect = 9e-61
 Identities = 169/395 42%, Positives = 235/395 59%, Gaps = 16/395 4%
Query  4    IKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHKR 63
            I + + ++ A L  V GA + E    A+ IP KYIV  K         +HT W +     
Sbjct  4    ITKAIPIVLAALSTVNGARILEAGPHAEAIPNKYIVVMKREVSDEAFNAHTTWLSQSLNS 63
Query  64   NLERRDTTSGEPPVGIEKSYKIKD-FAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYLDA 122
             + RR   S +P  G++  Y +   F AY+G FDDA I++I    DV  +E D +     
Sbjct  64   RIMRR-AGSSKPMAGMQDKYSLGGIFRAYSGEFDDAMIKDISSHDDVDFIEPDFVVRTTT 122
Query  123  ----LTTQKGAP-WGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRAS 177
                LT Q   P WGL  +  K    T Y YD SAG G  AY++D+GI+++H +F+ RA 
Sbjct  123  NGTNLTHQDNVPSWGLARVGSKKPGGTTYYYDPSAGKGVTAYIIDTGIDIDHEDFQGRAK 182
Query  178  LAYNAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESS-STSIILDGFNW 236
               N     + D  GHGTHVAGT+GG  YG+AK  +L++VKV+  + S S S ++ G  W
Sbjct  183  WGENFVDQQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNSGVIKGMEW 242
Query  237  AVNDIVSKGR-TKKAA----INMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASN 291
            A+      G  T KAA    +NMSLGG  S A N A +   D G++  VAAGNEN DA +
Sbjct  243  AMRQASGGGNGTAKAAGKSVMNMSLGGPRSEASNQAAKAISDAGIFMAVAAGNENMDAQH 302
Query  292  TSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMA 351
            +SPAS P+  TVAA  K + +A FSNYG+VVD++APG+DI S   G +T  +T+SGTSMA
Sbjct  303  SSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKDITSLKPGGST--DTLSGTSMA 360
Query  352  TPHIVGLSVYLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGN 402
            +PH+ GL  YL+GL    GP  +   IK++A + + +  +G+  KL YNG+
Sbjct  361  SPHVCGLGAYLIGLGKQGGPG-LCDTIKKMANDVIQSPGEGTTGKLIYNGS 410

Sequence Alignment: 6. Allergen Name: Pen c 13.0101 Sequence ID: AAD25926

 Score = 224.1 bits 955,  Expect = 9e-60
 Identities = 161/361 44%, Positives = 218/361 60%, Gaps = 10/361 2%
Query  33   IPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERRDTTSGEPPVGIEKSYKIKDFAAYA 92
            IP  YIV       TA   +H  WAT++H R L RR   +GE   G  K ++I  +  Y 
Sbjct  32   IPSSYIVVMNDDVSTAEFNTHREWATNVHAR-LSRRK--NGETGPG--KHFEINGLKGYT 86
Query  93   GSFDDATIEEIRKRGDVAHVEEDQIWYLDALTTQKGAP-WGLGSISHKGQASTDYIYDTS 151
             SFD++T ++I     V ++E D I    A   Q   P WGL  IS K   +T Y YD++
Sbjct  87   ASFDESTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
Query  152  AGAGTYAYVVDSGINVNHVEFESRASLAYNAAGGSHVDSIGHGTHVAGTIGGKTYGVAKK 211
            AG G   Y VD+GI+++H +F  RA    N     + D  GHGTH A T  G  YGVAKK
Sbjct  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
Query  212  TNLLSVKVFQGESSST-SIILDGFNWAVNDIVSKGRTKKAAINMSLGGGYSYAFNNAVEN 270
              L++VKV+  + S T S ++ G +WAV D  S+G   K  +NMSLGG +S A N+A  N
Sbjct  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNMSLGGEFSKAVNDAAAN 266
Query  271  AFDEGVLSVVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQD 330
                G++  VAAGNE  +ASN+SPASA    T+AA   ++  ASF+N+GSVVD++APGQ 
Sbjct  267  VVKSGIFLSVAAGNEAENASNSSPASAAEVCTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
Query  331  ILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKELATNGVVTNV 390
            I +A+ G    + T+SGTSMA PH+ G++ YLM LE +S   A  ARI +LAT+ +    
Sbjct  327  ITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVSAGNAC-ARIVQLATSSISRAP 383
Query  391  KGSPNKLAYNG 401
             G+ +KL YNG
Sbjct  384  SGTTSKLLYNG 394

Sequence Alignment: 7. Allergen Name: Pen ch 13 Sequence ID: AAF23726

 Score = 222.7 bits 949,  Expect = 2e-59
 Identities = 161/361 44%, Positives = 217/361 60%, Gaps = 10/361 2%
Query  33   IPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERRDTTSGEPPVGIEKSYKIKDFAAYA 92
            IP  YIV       TA   +H  WAT++H R L RR   +GE   G  K ++I  +  Y 
Sbjct  32   IPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRRK--NGETGPG--KHFEINGLKGYT 86
Query  93   GSFDDATIEEIRKRGDVAHVEEDQIWYLDALTTQKGAP-WGLGSISHKGQASTDYIYDTS 151
             SFD+ T ++I     V ++E D I    A   Q   P WGL  IS K   +T Y YD++
Sbjct  87   ASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
Query  152  AGAGTYAYVVDSGINVNHVEFESRASLAYNAAGGSHVDSIGHGTHVAGTIGGKTYGVAKK 211
            AG G   Y VD+GI+++H +F  RA    N     + D  GHGTH A T  G  YGVAKK
Sbjct  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
Query  212  TNLLSVKVFQGESSST-SIILDGFNWAVNDIVSKGRTKKAAINMSLGGGYSYAFNNAVEN 270
              L++VKV+  + S T S ++ G +WAV D  S+G   K  +N SLGG +S A N+A  N
Sbjct  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNTSLGGEFSKAVNDAAAN 266
Query  271  AFDEGVLSVVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQD 330
                G++  VAAGNE  +ASN+SPASA  A T+AA   ++  ASF+N+GSVVD++APGQ 
Sbjct  267  VVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
Query  331  ILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKELATNGVVTNV 390
            I +A+ G    + T+SGTSMA PH+ G++ YLM LE +S   A  ARI +LAT+ +    
Sbjct  327  ITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVSAGNAC-ARIVQLATSSISRAP 383
Query  391  KGSPNKLAYNG 401
             G+ +KL YNG
Sbjct  384  SGTTSKLLYNG 394

Sequence Alignment: 8. Allergen Name: Rho m 2.0101 Sequence ID: Q32ZM1

 Score = 166.2 bits 701,  Expect = 2e-42
 Identities = 147/302 48%, Positives = 198/302 65%, Gaps = 21/302 6%
Query  100  IEEIRKRGDVAHVEEDQIWYLDALTTQKGAPWGLGSISHKGQAST----DYIYDTSAGAG 155
            IE++R+   V  +E++ + + + +T  KGAPWGL  ISH+   S      Y+YD++ G G
Sbjct  9    IEQVRQLPMVNFIEKNSLVHANEFTVAKGAPWGLARISHRDPLSLGSFDQYLYDSNGGTG 68
Query  156  TYAYVVDSGINVNHVEFESRASLAYNAAGGSH-VDSIGHGTHVAGTIGGKTYGVAKKTNL 214
              +YV+D+G+NV+H +FE RA        G    D  GHGTH AGTIG   YGVAK   +
Sbjct  69   VTSYVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYGVAKNAEI 128
Query  215  LSVKVFQGESS-STSIILDGFNWAVN---DIVSKGRTKKAAINMSLGGGYSYAFNNAVEN 270
            ++VKV++   S S S ++ G  +AV    D V KG+   +  NMSLGGG S A++ AV  
Sbjct  129  VAVKVLRSNGSGSMSDVIKGVEFAVKSHQDSVKKGKNSFSTANMSLGGGKSPALDLAVNA 188
Query  271  AFDEGVLSVVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQD 330
            A   G+   VAAGNEN DA NTSPASA NA+TV A   S+ARA FSNYG  VDIFAPG +
Sbjct  189  AVKAGLHFAVAAGNENQDACNTSPASAENAITVGASTISDARAYFSNYGKCVDIFAPGLN 248
Query  331  ILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLS------GPAAVT-ARIKE--- 380
            ILS +IGS  AT  +SGTSMA+PHI GL  Y + L+  S      G   +T A++K+   
Sbjct  249  ILSTYIGSDAATAYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGITPAQLKKNLI 308
Query  381  -LATNGVVTNVKG-SPNKLAYNG 401
             + T  V+ ++   +PN LA+NG
Sbjct  309  AFGTPDVLADIPADTPNILAFNG 331

Sequence Alignment: 9. Allergen Name: Pen ch 18 Sequence ID: AAF71379

 Score = 164.7 bits 695,  Expect = 8e-42
 Identities = 167/380 43%, Positives = 234/380 61%, Gaps = 31/380 8%
Query  21   APVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLH-----KRNLERRDTTSG-- 73
            AP+  +   ++ IP  YIV FK   D ++  +H  W  ++H     +  L++R       
Sbjct  29   APIL-SSMTSKDIPDSYIVVFKKHVDPSSASAHQSWLQEVHTAHTGRMELKKRSLFGFDF 87
Query  74   EPPVGIEKSYKIK-DFAAYAGSFDDATIEEIRKRGDVAHVEED-QIWYLDALTTQKGAPW 131
            E  +G++ ++ I   +  YAG F +  IE+IR+  DV ++E+D ++  +   + +K APW
Sbjct  88   EAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTMSEGSVEKNAPW 147
Query  132  GLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAA-GGS 186
            GL  ISH+   S      Y+Y    G G  AYV+D+G NV HV+FE RA+       G +
Sbjct  148  GLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVKHVDFEGRANWGKTIPQGDA 207
Query  187  HVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST-SIILDGFNWAVNDIVSKG 245
              D  GHGTH +GTI GK +GVAKK N+ +VKV++   S T S ++ G  WA    + K 
Sbjct  208  DEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKKS 267
Query  246  RT-----KKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
            +      K +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+DA N SPA+A  A
Sbjct  268  KKGDKKFKGSVANMSLGGGSSRTLDLAVNAAVDAGIHFAVAAGNDNADACNYSPAAAEKA 327
Query  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
            +TV A   ++ RA FSNYG   DIFAPG +ILS W+GS  ATNTISGTSMA+PHI GL  
Sbjct  328  ITVGASTLADERAYFSNYGKCTDIFAPGLNILSTWVGSDHATNTISGTSMASPHIAGLLA 387
Query  361  YLMGLENLSGPAAVTARI--KEL-------ATNGVVTNVKG-SPNKLAYNG 401
            Y + L      A   A +  K+L       AT G +T++   +PN LA+NG
Sbjct  388  YYVSLAPAKDSAYAVADVTPKQLKAALISVATEGTLTDIPSDTPNLLAWNG 438

Sequence Alignment: 10. Allergen Name: Alt a 15.0101 Sequence ID: A0A0F6N3V8

 Score = 109.6 bits 453,  Expect = 3e-25
 Identities = 170/376 45%, Positives = 230/376 61%, Gaps = 39/376 10%
Query  24   QETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERR---DTTSGEPPV--- 77
            Q    +A+++P  Y+V FK     A+   H  W   +H +N E R      S + PV   
Sbjct  2    QRQMDSAKEVPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNNEERMELRKRSSQFPVTTE 59
Query  78   ---GIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEED-QIWYL--DALTTQKGAPW 131
               G++  Y++     Y+G FDD TIE IR   DV ++E D ++  L  D    +K +PW
Sbjct  60   VFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPW 119
Query  132  GLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAAGG-S 186
            GL  ISH+   S      Y+Y    G G   YV+D+G N  HV+FE RA        G +
Sbjct  120  GLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPNGDA 179
Query  187  HVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST-SIILDGFNWAV---NDIV 242
              D  GHGTH +GT+ GK YGVAKK ++ +VKV++   S T S ++ G  +A    +D V
Sbjct  180  DEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTV 239
Query  243  SKGRTKK------AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPAS 296
               +  K      +A NMSLGGG S  ++ AV  A D G+   VAAGN+N+D+ N SPA+
Sbjct  240  QAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAA 299
Query  297  APNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIV 356
            A NA+TV A    + RA FSNYG   DIFAPG +ILS WIGS  ATNTISGTSMA+PHI 
Sbjct  300  AENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIA 359
Query  357  GLSVYLMGLENLSGPAAVTARI--KEL-------ATNGVVTNV-KGSPNKLAYNG 401
            GL  Y++ L+     A   A I  K+L       AT G +++V + + N LA+NG
Sbjct  360  GLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNG 414

Sequence Alignment: 11. Allergen Name: Cur l 4.0101 Sequence ID: ACF19589

 Score = 107.5 bits 444,  Expect = 1e-24
 Identities = 169/378 44%, Positives = 235/378 62%, Gaps = 40/378 10%
Query  21   APVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERR---DTTSGEPPV 77
            APV  +  +A+++P  Y+V FK     A+   H  W   +H +N + R      S + PV
Sbjct  29   APVL-SSTSAKEVPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNTQERMELRKRSSDLPV 85
Query  78   ------GIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEED-QIWYL--DALTTQKG 128
                  G++ +Y++  +  Y+G FDD T+E IR   DV ++E D ++  L  D   T+  
Sbjct  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
Query  129  APWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAAG 184
            +PWGL  ISH+   S      Y+Y    G G   YV+D+G NV+HV+FE RA        
Sbjct  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
Query  185  G-SHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST-SIILDGFNWAV---N 239
            G +  D  GHGTH +GT+ GK YGVAKK ++ +VKV++   S T S ++ G  +A    +
Sbjct  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
Query  240  DIVSKGRTKK------AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTS 293
            + VS  +  K      +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+D+ N S
Sbjct  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
Query  294  PASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATP 353
            PA+A NA+TV A    + RA FSNYG   DIFAPG +ILS WIGS  ATNTISGTSMA+P
Sbjct  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
Query  354  HIVGLSVYLMGLENLSGPAAVTARI--KELATN-------GVVTNV-KGSPNKLAYNG 401
            HI GL  Y++ L+     A   A I  K+L  N       G +++V   + N LA+NG
Sbjct  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443

Sequence Alignment: 12. Allergen Name: Cla c 9.0101 Sequence ID: ABQ59329

 Score = 106.9 bits 441,  Expect = 2e-24
 Identities = 136/276 49%, Positives = 176/276 63%, Gaps = 25/276 9%
Query  126  QKGAPWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYN 181
            +K APWGL  ISH+   S      Y+Y    G G   YVVD+G NV+HV+FE RAS    
Sbjct  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
Query  182  AA-GGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESS-STSIILDGFNWAVN 239
               G +  D  GHGTH +GT+ GK YGVAKK ++ +VKV++   S S S ++ G  +A  
Sbjct  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
Query  240  D------IVSKGRTKK---AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDAS 290
                   I  KG+ K    +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+D+ 
Sbjct  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
Query  291  NTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSM 350
            N SPA+A NA+TV A   S+ RA FSNYG   DIFAPG +I S WIGS  A NTISGTSM
Sbjct  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
Query  351  ATPHIVGLSVYLMGLENLS---------GPAAVTARIKELATNGVVTNV-KGSPNKLAYN 400
            A+PH+ GL  YL+ L+             P  + A +  +AT G +T+V   + N LA+N
Sbjct  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
Query  401  G 401
            G
Sbjct  314  G 314

Sequence Alignment: 13. Allergen Name: Cla h 9.0101 Sequence ID: AAX14379

 Score = 106.8 bits 441,  Expect = 2e-24
 Identities = 169/380 44%, Positives = 229/380 60%, Gaps = 37/380 9%
Query  21   APVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLH------KRNLERRDTTSGE 74
            AP+  +   A++I   Y++ FK          H  W  DLH      K  L +R  +   
Sbjct  29   APII-SASNAKEIADNYMIKFKDHVTQNLAAEHHGWVQDLHEKTQVAKTELRKRSQSPMV 87
Query  75   PPV--GIEKSYKIKD-FAAYAGSFDDATIEEIRKRGDVAHVEEDQ-IWYLDALT-TQKGA 129
              +  G++ +Y I   +  YAG FD+  IE+IR+  DV  VE DQ +  L + +  +K A
Sbjct  88   DDIFNGLKHTYNIAGGLMGYAGHFDEDVIEQIRRHPDVELVERDQEVHVLGSESEVEKNA 147
Query  130  PWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAA-G 184
            PWGL  ISH+   S      Y+Y    G G   YVVD+G NV+HV+FE RAS       G
Sbjct  148  PWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKTIPQG 207
Query  185  GSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESS-STSIILDGFNWAVND--- 240
             +  D  GHGTH +GT+ GK YGVAKK ++ +VKV++   S S S ++ G  +A      
Sbjct  208  DADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAESHLE 267
Query  241  ---IVSKGRTKK---AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSP 294
               I  KG+ K    +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+D+ N SP
Sbjct  268  QVSITKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSCNYSP 327
Query  295  ASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPH 354
            A+A NA+TV A   ++ RA FSNYG   DIFAPG +I S WIGS  A NTISGTSMA+PH
Sbjct  328  AAAENAVTVGASTLADERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSMASPH 387
Query  355  IVGLSVYLMGLENLS---------GPAAVTARIKELATNGVVTNV-KGSPNKLAYNG 401
            + GL  YL+ L+             P  + A +  +AT G +T+V   + N LA+NG
Sbjct  388  VAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWNG 444

Sequence Alignment: 14. Allergen Name: Pen o 18 Sequence ID: AAG44478

 Score = 105.0 bits 433,  Expect = 8e-24
 Identities = 171/382 44%, Positives = 238/382 62%, Gaps = 33/382 8%
Query  20   GAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHKRN----LERRDTTS--G 73
            GA    +  +A++IP  YIV FK     +   +H  W  D+H  N    L++R       
Sbjct  27   GAAPLISSTSAKEIPDSYIVVFKKHVGASAASAHHSWVQDIHSDNVRMELKKRSLFGFES 86
Query  74   EPPVGIEKSYKIK-DFAAYAGSFDDATIEEIRKRGDVAHVEED-QIWYLDALTTQKGAPW 131
            EP +G++ ++ +   +  YAG F +  IE++R+  DV ++E+D ++ +++    +K APW
Sbjct  87   EPYLGVKHTFHVAGSLMGYAGHFHEDVIEQVRRHPDVEYIEKDSEVHHFEDPAIEKNAPW 146
Query  132  GLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAAGGSH 187
            GL  ISH+   S      Y+Y    G G  AYV+D+G NV+HV+FE RAS       G +
Sbjct  147  GLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTNVDHVDFEGRASWGKTIPQGDQ 206
Query  188  -VDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST-SIILDGFNWAVNDIVSKG 245
             VD  GHGTH +GTI GK YGVAKK N+ +VKV++   S T S ++ G  WA    + K 
Sbjct  207  DVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKKS 266
Query  246  RTKK---------AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPAS 296
            +  K         +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+DA N SPA+
Sbjct  267  KAAKDGKAKGFKGSVANMSLGGGSSRTLDLAVNAAVDAGMHFAVAAGNDNADACNYSPAA 326
Query  297  APNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIV 356
            A  A+TV A   ++ RA FSNYG   DIFAPG +ILS WIGS  A NTISGTSMA+PHI 
Sbjct  327  AEKAVTVGASTLADERAYFSNYGKCTDIFAPGLNILSTWIGSKYAVNTISGTSMASPHIA 386
Query  357  GLSVYLMGLENLSGPAAVTARI--KEL-------ATNGVVTNVKG-SPNKLAYNG 401
            GL  Y + L+  S  A     I  K+L       AT+G ++++   +PN LA+NG
Sbjct  387  GLLAYYVSLQPASDSAYAVEEITPKKLKDALITIATSGALSDIPSDTPNLLAWNG 441

Sequence Alignment: 15. Allergen Name: Asp f 18.0101 Sequence ID: Y13338

 Score = 100.5 bits 413,  Expect = 2e-22
 Identities = 173/394 43%, Positives = 238/394 60%, Gaps = 39/394 9%
Query  8    LLLLGAVLPAVF-----GAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHK 62
            L LL A  P V      GA    +   A+++P  YIV FK   +  +  +H  W  D+H 
Sbjct  10   LPLLVAASPVVVDSIHNGAAPILSSMNAKEVPDSYIVVFKKHVNAESAAAHHSWVQDIHS 69
Query  63   RNLERRDTTS------GEPP-VGIEKSYKIK-DFAAYAGSFDDATIEEIRKRGDVAHVEE 114
               ER +         GE   +G++ ++ I   +  Y+G F +  IE++RK  DV ++E+
Sbjct  70   AQNERVELRKRSLFGFGEEAYLGLKNTFDIAGSLVGYSGHFHEDVIEQVRKHPDVEYIEK 129
Query  115  D-QIWYLDALTTQKGAPWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNH 169
            D ++  ++  T +K APWGL  ISH+   S      Y+Y +  G G  AY +D+GINV+H
Sbjct  130  DSEVHTMEDPTVEKSAPWGLARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVDH 189
Query  170  VEFESRASLAYNAAGGSH-VDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST- 227
            V+FE RA             D  GHGTH +GTI G+ YGVAKK NL +VKV++   S T 
Sbjct  190  VDFEGRAQWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGSGTM 249
Query  228  SIILDGFNWAVNDIVSK------GRTK--KAAI-NMSLGGGYSYAFNNAVENAFDEGVLS 278
            S ++ G  WAV   + K      G+ K  K ++ NMSLGGG S  +  AV    + G+  
Sbjct  250  SDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTLEAAVNAGVEAGLHF 309
Query  279  VVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGS 338
             VAAGN+N+DA N SPA+A N +TV A    + RA FSNYG   DIFAPG +ILS WIGS
Sbjct  310  AVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNYGKCTDIFAPGLNILSTWIGS 369
Query  339  TTATNTISGTSMATPHIVGLSVYLMGLENLSG---------PAAVTARIKELATNGVVTN 389
              A NTISGTSMA+PHI GL  Y++ L+             P  +   I  +AT G +T+
Sbjct  370  KHAVNTISGTSMASPHIAGLLAYFVSLQPSKDSAFAVDELTPKKLKKDIIAIATQGALTD 429
Query  390  VKG-SPNKLAYNG 401
            +   +PN LA+NG
Sbjct  430  IPSDTPNLLAWNG 442

Sequence Alignment: 16. Allergen Name: Fus p 9.0101 Sequence ID: A0A0U1Y1N5

 Score = 98.9 bits 406,  Expect = 4e-22
 Identities = 131/277 47%, Positives = 182/277 65%, Gaps = 25/277 9%
Query  125  TQKGAPWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
            T++ APWGL  ISH+   +      Y+Y +  G G  AY+VD+G NV+HV+FE RA    
Sbjct  7    TERQAPWGLARISHRNTLNFGTFNKYLYSSDGGEGVDAYIVDTGTNVDHVDFEGRAHWGK 66
Query  181  NA-AGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESS-STSIILDGFNWAV 238
               +G +  D  GHGTH +GT+ GK YGVAKK N+ +VKV++   S S S ++ G  +A 
Sbjct  67   TIPSGDADEDGNGHGTHCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKGVEFAA 126
Query  239  NDIVSK------GRTK--KAAI-NMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDA 289
               + +      G+ K  K ++ NMSLGGG + A++ AV  A   G+   VAAGN+N+DA
Sbjct  127  TSHLEQKKKAKDGKRKGFKGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGNDNADA 186
Query  290  SNTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTS 349
             N SPA+A   +TV A    ++RA FSNYG   DIFAPG +I S WIGS  A NTISGTS
Sbjct  187  CNYSPAAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNTISGTS 246
Query  350  MATPHIVGLSVYLMGLENLSGP----AAVTAR-IKE----LATNGVVTNVKG-SPNKLAY 399
            MA+PHI GL  Y + L+         A++T + +KE    +AT   ++++   +PN LA+
Sbjct  247  MASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALSDIPSDTPNLLAW 306
Query  400  NG 401
            NG
Sbjct  307  NG 308

Sequence Alignment: 17. Allergen Name: Cuc m 1 Sequence ID: BAA06905

 Score = 39.5 bits 146,  Expect = 0.0006
 Identities = 41/115 35%, Positives = 65/115 56%, Gaps = 20/115 17%
Query  276  VLSVVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVV--DIFAPGQDILS 333
            + S+ + G     ++    ASAP  + V+  ++   RA+      V+  DI  PG +IL+
Sbjct  448  IYSIRSPGATIFKSTTILNASAP--VVVSFSSRGPNRAT----KDVIKPDISGPGVEILA 501
Query  334  AW-----IGS---TTATNTISGTSMATPHIVGLSVYLMGLENLSGPAAVTARIKELATNG 385
            AW     +G     T  N ISGTSM+ PHI G++ Y+        PAA+ +    L T  
Sbjct  502  AWPSVAPVGGIRRNTLFNIISGTSMSCPHITGIATYVKTYNPTWSPAAIKS---ALMTTA 558
Query  386  VVTNVKGSPN-KLAY 399
               N + +P  ++AY
Sbjct  559  SPMNARFNPQAEFAY 573

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.