The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNL
LKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQR
EEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESE
ESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNS
KPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSR
EEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG
KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ
QQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLA
GSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
LRAFY
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA35691 Gly m conglycinin 605 4017 488.1 7e-139
O22120 Gly m 5.0101 543 3575 435.8 3.4e-123
Q9FZP9 Gly m 5.0201 559 2664 328.1 9.5e-91
AAB23463 Gly m conglycinin 439 2108 262.4 4.5e-71
AAB01374 Gly m conglycinin 639 2033 253.4 3.2e-68
Q198W3 Vig r 2.0101 453 1905 238.4 7.9e-64
B1NPN8 Vig r 2.0201 454 1880 235.4 6.1e-63
AAA33947 Gly m conglycinin 218 1366 174.7 5.4e-45
ACB05815 Lup an 1.0101 611 1307 167.6 2.1e-42
CAD87730 Len c 1.0101 418 1178 152.4 5.5e-38
CAD87731 Len c 1.0102 415 1153 149.4 4.2e-37
AAF18269 Jug r 2 593 1154 149.5 5.8e-37
CAF25232 Pis s 1.0101 415 1140 147.9 1.2e-36
CAF25233 Pis s 1.0102 415 1123 145.9 4.9e-36
B3STU4 Car i 2.0101 792 1082 140.9 2.9e-34
AAM54366 Jug n 2 481 1061 138.5 9.4e-34
Q9SPL4 Mac i 1.0201 666 1027 134.5 2.2e-32
Q9SPL3 Mac i 1.0101 625 1025 134.2 2.4e-32
P09801 Gos h 1 588 998 131.0 2.1e-31
P09799 Gos h 2 605 951 125.5 1e-29
P43238 Ara h 1 626 738 100.3 4e-22
P43237 Ara h 1 614 734 99.8 5.4e-22
AAK15089 Ses i 3 585 671 92.4 9e-20
A0A2I4E5L6 Jug r 6.0101 502 616 85.9 6.9e-18
EF116865 Pis v 3.0101 519 579 81.5 1.5e-16
V9VGU0 Pin k 2.0101 463 485 70.4 2.9e-13
AAL86739 Cor a 11 448 476 69.4 5.8e-13
AAM73729 Ana o 1.0102 536 461 67.6 2.4e-12
AAM73730 Ana o 1.0101 538 461 67.6 2.4e-12
BAB21619 Gly m Bd28K 473 255 43.2 4.6e-05
A0A0S3B0K0 Coc n 1.0101 490 232 40.5 0.00031
Q9SB11 Gly m 6.0401 563 216 38.6 0.0014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 488.1 bits 4017,  Expect = 7e-139
 Identities = 605/605 100%, Positives = 605/605 100%, Gaps = 0/605 0%
Query  1    MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNL 60
            MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNL
Sbjct  1    MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNL 60
Query  61   LKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQR 120
            LKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQR
Sbjct  61   LKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQR 120
Query  121  EEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESE 180
            EEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESE
Sbjct  121  EEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESE 180
Query  181  ESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNS 240
            ESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNS
Sbjct  181  ESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNS 240
Query  241  KPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN 300
            KPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
Sbjct  241  KPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN 300
Query  301  NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSR 360
            NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSR
Sbjct  301  NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSR 360
Query  361  EEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
            EEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG
Sbjct  361  EEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
Query  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
            KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ
Sbjct  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
Query  481  QQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLA 540
            QQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLA
Sbjct  481  QQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLA 540
Query  541  GSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI 600
            GSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
Sbjct  541  GSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI 600
Query  601  LRAFY 605
            LRAFY
Sbjct  601  LRAFY 605

Sequence Alignment: 2. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 435.8 bits 3575,  Expect = 3e-123
 Identities = 541/543 99%, Positives = 542/543 99%, Gaps = 0/543 0%
Query  63   VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREE 122
            VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREE
Sbjct  1    VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREE 60
Query  123  QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEES 182
            QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEER +EEDEDEEQQRESEES
Sbjct  61   QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERKQEEDEDEEQQRESEES 120
Query  183  EDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKP 242
            EDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKP
Sbjct  121  EDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKP 180
Query  243  NTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNE 302
            NTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNE
Sbjct  181  NTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNE 240
Query  303  NLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREE 362
            NLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREE
Sbjct  241  NLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREE 300
Query  363  GQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKF 422
            GQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKF
Sbjct  301  GQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKF 360
Query  423  FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ 482
            FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ
Sbjct  361  FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ 420
Query  483  EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGS 542
            EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGS
Sbjct  421  EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGS 480
Query  543  QDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILR 602
            QDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILR
Sbjct  481  QDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILR 540
Query  603  AFY 605
            AFY
Sbjct  541  AFY 543

Sequence Alignment: 3. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 328.1 bits 2664,  Expect = 9e-91
 Identities = 466/533 87%, Positives = 502/533 94%, Gaps = 33/533 6%
Query  64   EKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRP-QPRQEEEHEQREE 122
            E+EECEEG+IPRPR  PQHPERE QQ GEKEEDE EQPRP PFPRP QP QEEEHEQ+EE
Sbjct  3    EEEECEEGQIPRPR--PQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
Query  123  QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERN---------------- 166
            +EW RKEEK G KGSEEE       QDER+ P P  PHQKEE                  
Sbjct  61   HEWHRKEEKHGGKGSEEE-------QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESE 113
Query  167  ---EEEDEDEEQQRESEESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIRVLQR 219
               E++DEDEEQ +ES+ESE SE     RRHKNKNPF F S RF+TLFKNQYG +RVLQR
Sbjct  114  EEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQR 173
Query  220  FNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRL 279
            FN+RS QLQNLRDYRILEFNSKPNTLLLP+HADADYLIVILNGTAIL+LVNNDDRDSY L
Sbjct  174  FNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNL 233
Query  280  QSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSR 339
            QSGDALRVP+GTTYYVVNPDN+ENLR+ITLAIPVNKPGRFESFFLSST+AQQSYLQGFS+
Sbjct  234  QSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSK 293
Query  340  NILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI 399
            NILEASYDTKFEEINKVLF REEGQQQGE+RLQESVIVEISK+QIR LSK AKSSSRKTI
Sbjct  294  NILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTI 353
Query  400  SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKA 459
            SSEDKPFNLRSRDPIYSNKLGK+FEITPEKNPQLRDLD+FLS+VDMNEGAL+LPHFNSKA
Sbjct  354  SSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
Query  460  IVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT 519
            IV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT
Sbjct  414  IVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT 473
Query  520  SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFV 579
            S+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFPGSA+ +E L+K+Q ESYFV
Sbjct  474  SDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFV 533
Query  580  DAQPKKKEEGNKGRKGPLSSILRAFY 605
            DAQP++KEEGNKGRKGPLSSILRAFY
Sbjct  534  DAQPQQKEEGNKGRKGPLSSILRAFY 559

Sequence Alignment: 4. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 262.4 bits 2108,  Expect = 5e-71
 Identities = 320/412 77%, Positives = 372/412 90%, Gaps = 6/412 1%
Query  189  RHKNKNPFLF-GSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLL 247
            R    NPF F  SN F+TLF+NQ  RIR+LQRFN+RSPQL+NLRDYRI++F SKPNT+LL
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  248  PNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLI 307
            P+HADAD+L+ +L+G AIL+LVNNDDRDSY L+ GDA R+P+GTTYY+VNP +++NL++I
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  308  TLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQG 367
             LAIPVNKPGR++ FFLSST+AQQSYLQGFS NILE S+ ++FEEIN+VLF  EE     
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEE----- 201
Query  368  EQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITP 427
            EQR QE VIVE+SKEQIR LS+RAKSSSRKTISSED+PFNLRSR+PIYSN +GKFFEITP
Sbjct  202  EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITP 261
Query  428  EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE 487
            EKNPQLRDLDIFLS VD+NEGALLLPHFNSKAIVILVINEGDANIELVG+KEQQQ+Q+QE
Sbjct  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQE 321
Query  488  EQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVI 547
            E+PLEV++YRAELSE D+FVIPA YP VVNATSNLNF+A GINAENNQRNFLAG +DNV+
Sbjct  322  EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
Query  548  SQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 605
             QI  QVQELAFPGSAQ VE+LLK QRESYFVDAQP++KEEG+KGRKGP+ SIL A+Y
Sbjct  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439

Sequence Alignment: 5. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 253.4 bits 2033,  Expect = 3e-68
 Identities = 517/595 86%, Positives = 561/595 94%, Gaps = 54/595 9%
Query  1    MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNL 60
            MMRARFPLLLLG+VFLASVSVSFGIAYWEK+NP HNKCL+SCNSE+DSYRNQACHARCNL
Sbjct  1    MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL 60
Query  61   LKVEKEE-CEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRP-QPRQEEEHE 118
            LKVE+EE CEEG+IPRPR  PQHPERE QQ GEKEEDE EQPRP PFPRP QP QEEEHE
Sbjct  61   LKVEEEEECEEGQIPRPR--PQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHE 118
Query  119  QREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERN------------ 166
            Q+EE+EW RKEEK G KGSEEE       QDER+ P P  PHQKEE              
Sbjct  119  QKEEHEWHRKEEKHGGKGSEEE-------QDEREHPRPHQPHQKEEEKHEWQHKQEKHQG 171
Query  167  -------EEEDEDEEQQRESEESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIR 215
                   E++DEDEEQ +ES+ESE SE     RRHKNKNPF F S RF+TLFKNQYG +R
Sbjct  172  KESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVR 231
Query  216  VLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRD 275
            VLQRFN+RS QLQNLRDYRILEFNSKPNTLLLP+HADADYLIVILNGTAIL+LVNNDDRD
Sbjct  232  VLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRD 291
Query  276  SYRLQSGDALRVPSGTTYYVVNPDNNENLRLI-------------------TLAIPVNKP 316
            SY LQSGDALRVP+GTT+YVVNPDN+ENLR+I                   TLAIPVNKP
Sbjct  292  SYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKP 351
Query  317  GRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVI 376
            GRFESFFLSST+AQQSYLQGFS+NILEASYDTKFEEINKVLF REEGQQQGE+RLQESVI
Sbjct  352  GRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVI 411
Query  377  VEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDL 436
            VEISK+QIR LSK AKSSSRKTISSEDKPFNL SRDPIYSNKLGK+FEIT ++NPQLRDL
Sbjct  412  VEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDL 470
Query  437  DIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKY 496
            D+FLS+VDMNEGAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKY
Sbjct  471  DVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKY 530
Query  497  RAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQE 556
            RAELSEQDIFVIPAGYPV+VNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQE
Sbjct  531  RAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQE 590
Query  557  LAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 605
            LAFP SA+ +E L+K+Q ESYFVDAQP++KEEGNKGRKGPLSSILRAFY
Sbjct  591  LAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639

Sequence Alignment: 6. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 238.4 bits 1905,  Expect = 8e-64
 Identities = 285/425 67%, Positives = 367/425 86%, Gaps = 8/425 1%
Query  176  QRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 234
            +RE +ES++    R +N NPF F S+R F TLFKNQYG +RV++RF+QRS Q+QNL +YR
Sbjct  26   HREHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR 84
Query  235  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 294
            ++EF SKPNTLLLP+HADAD+L+V+LNG AIL+LVN D RDSY L+ G A ++P+GTT++
Sbjct  85   VVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF 144
Query  295  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 354
            +VNP++N+NLR+I LAIPVN P RF++FFLSSTEAQQSYL+GFS+NILEAS+D+ F+EI+
Sbjct  145  LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEID 204
Query  355  KVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPI 414
            +VLF  E  QQ+GE+  +E VIVE+ +EQIR L K AKSSSRK +SS+D+PFNLR+ +PI
Sbjct  205  RVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPI 264
Query  415  YSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIEL 474
            YSNK+G+++EITPEKNPQL+DLD+F+S VDM EG LLLPH+NSKAIVILVINEG+A IEL
Sbjct  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
Query  475  VGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENN 534
            VG      +QQQ+++ LEV++YRAELSE D+FVIPA YPV +NATSNLNFFA GINAENN
Sbjct  325  VG----PSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENN 380
Query  535  QRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP--KKKEEGNKG 592
            QRNFLAG +DNV+S+IP++V +++FP S   VEKL+K Q ES+FVDAQP  +++EEG+KG
Sbjct  381  QRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKG 440
Query  593  RKGPLSSILRAFY 605
            RKG LSSIL ++Y
Sbjct  441  RKGSLSSILGSLY 453

Sequence Alignment: 7. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 235.4 bits 1880,  Expect = 6e-63
 Identities = 281/420 66%, Positives = 361/420 85%, Gaps = 7/420 1%
Query  176  QRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 234
            +RE+ +  +  + R KN NPF F S+R F TLF+NQ+G +RVLQRF+QRS Q+QNL +YR
Sbjct  28   HRENIDGAEVSVSRGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYR 86
Query  235  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 294
            ++E+ SKPNTLLLP+HADAD+L+V+LNG A+L+LVN D RDS  L+ G A ++P+GTT++
Sbjct  87   VVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFF 146
Query  295  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 354
            +VNPD+NENLR+I LA+PVN P RF+ FFLSSTEAQQSYLQGFS+NILEAS+D+  +EI+
Sbjct  147  LVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEIS 206
Query  355  KVLFSREEGQQQ--GEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRD 412
            +VLF  EEGQQQ  G++  QE VIVE+ +EQIR L+K AKSSS+K++SSED+PFNLR++ 
Sbjct  207  RVLFG-EEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQK 265
Query  413  PIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANI 472
            PIYSNKLG++FEITPEKNPQLRDLD+F+  VDM EG+LLLPH+NSKAIVILVINEG ANI
Sbjct  266  PIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANI 325
Query  473  ELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAE 532
            ELVG +EQQ++Q+++E+  EV++YRAELSE D+F+IPA YPV +NATSNLNFFA GINAE
Sbjct  326  ELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAE 385
Query  533  NNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKK--KEEGN 590
            NNQRNFLAG +DNVIS+IP++V ++ FP S + V+KL+K Q ES FVDAQP++  +EE  
Sbjct  386  NNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445
Query  591  KGRKGPL 597
            KG KGP+
Sbjct  446  KGGKGPF 452

Sequence Alignment: 8. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 174.7 bits 1366,  Expect = 5e-45
 Identities = 214/218 98%, Positives = 215/218 98%, Gaps = 0/218 0%
Query  388  SKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 447
            SKRAKSSSRKTISSEDKPFNL SRDPIYS KLGKFFEITPEKNPQLRDLDIFLSIVDMNE
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  448  GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 507
            GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
Query  508  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 567
            IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
Sbjct  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
Query  568  KLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 605
            KLLKNQRESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218

Sequence Alignment: 9. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 167.6 bits 1307,  Expect = 2e-42
 Identities = 291/587 49%, Positives = 434/587 73%, Gaps = 38/587 6%
Query  2    MRARFPLL--LLGLVFL--ASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHAR 57
            MR R+P+L  LLG+VFL  AS+ +++G   + K  PK  +  +    ++   R Q  + R
Sbjct  4    MRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEEEHEPRQQPRPRQQEEQER 63
Query  58   CNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEH 117
             +     +EE  +GE  R R + +  + E ++   +   E EQ +    PRPQ RQEEE 
Sbjct  64   EH----RREEKHDGEPSRGRSQSEESQEEEHERRREHHREREQEQQ---PRPQRRQEEEE 116
Query  118  EQREEQEW-PRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQ 176
            E   E+EW PR++  +  +     +E E+ EQ++      +     E R   E     ++
Sbjct  117  E---EEEWQPRRQRPQSRR-----EEREEREQEQGSSSGSQRGGGDERRQHRERRVHREE 168
Query  177  RESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRIL 236
            RE E+   S+ RR++  NP+ F SNRF+T ++N+ G+IRVL+RFNQR+ +L+NL++YRI+
Sbjct  169  REQEQDSRSDSRRQR--NPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRII 226
Query  237  EFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVV 296
            EF SKPNTL+LP H+DAD+++V+LNG A +++VN D R  Y L+ GDALR+P+GTT Y++
Sbjct  227  EFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYIL 286
Query  297  NPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKV 356
            NPD+N+NLR+  LAIP+N PG++  F+ S+T+ QQSY+ GFS+N LEA+++T++EEI +V
Sbjct  287  NPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERV 346
Query  357  LFSREEGQQQGEQR-------LQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLR 409
            L+  +E Q+  +QR         E VIV +SK+QI+ L K A+SSS +   SE  PFNLR
Sbjct  347  LLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLR 406
Query  410  SRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGD 469
            S  PIYSNK+G F+EITP+ NPQ++DL+I L+  ++NEGALLLPH+NSKAI I+V++EG+
Sbjct  407  SNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGE 466
Query  470  ANIELVGLKEQQQEQQQEEQPLE-----VRKYRAELSEQDIFVIPAGYPVVVNATSNLNF 524
             N ELVG+++QQ++Q ++E+  E     VR+Y  +LS+ D+F+IPAG+P+ +NA+SNL +
Sbjct  467  GNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRL 526
Query  525  FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPK 584
            +  GINA  NQRNFLAGS+DNVI Q+  +V+EL FPGS + VE+L+KNQ++SYF +AQP+
Sbjct  527  LGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQ 586
Query  585  KKE----EGNKGRKGPLSSILRAFY 605
            +++    EG +GR+GP+SSIL A+Y
Sbjct  587  QQQQREKEGRRGRRGPISSILNALY 611

Sequence Alignment: 10. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 152.4 bits 1178,  Expect = 5e-38
 Identities = 230/399 57%, Positives = 334/399 83%, Gaps = 18/399 4%
Query  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
            R   +NPF+F SNRF+T+++N+ G IR+LQRF++RS  ++NL++YR+LE+ SKP+T++LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
Query  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
               DAD+++V+L+G AIL+++N++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
            LAIPVN+PG+++SF+LS T+ Q S+L GFS+NILEA+++T++EEI KVL+  +E + Q  
Sbjct  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
Query  369  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
            + L+        E VIV++S+EQI  LSK AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
Query  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLK-E 479
            KFFEITPEKNPQL+DLDIF++ V++ EG+LLLP++NS+AIVI+ +NEG  + ELVG + E
Sbjct  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
Query  480  QQQEQ---------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGIN 530
             QQEQ         Q+EE   +V++YRA LS  D++VIPAG+PV +NA+S+LN+   GIN
Sbjct  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGIN 361
Query  531  AENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587
            A+NNQRNFLAG +DNVISQI   V+ELAFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  362  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 11. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 149.4 bits 1153,  Expect = 4e-37
 Identities = 225/399 56%, Positives = 334/399 83%, Gaps = 15/399 3%
Query  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
            R   +NPF+F SNRF+T+++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP+TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
             + DAD+++V+L+G A+L+++N++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
            LAIPVN PG++ESF+LS T+ Q S+L GF+++ILEA+++T +EEI KVL+  +E + Q  
Sbjct  122  LAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHR 181
Query  369  QRL--------QESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
            + L        +E+VIV++S+EQI+ LSK AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  182  RSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
Query  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
            KFFEITPEKNPQL+DLDIF++ V++ EG+LLLP++NS+AIVI+ +NEG    ELVG + +
Sbjct  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
Query  481  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 533
             Q       E+Q+EE   +V++YRA+LS  D+FV+PAG+PV +NA+S+LN+   GINA+N
Sbjct  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKN 361
Query  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587
            NQRNFLAG +DNVISQI   V+ELAFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  362  NQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 12. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 149.5 bits 1154,  Expect = 6e-37
 Identities = 202/561 36%, Positives = 351/561 62%, Gaps = 42/561 7%
Query  29   EKENPK-----HNKCLQSCNSERDSYRNQA-CHARCNL-LKVEKEECEEGEIPRPRPRPQ 81
            ++ENP+     + +C + C  +    R Q  C+ RC   L+ ++   EE E  R R    
Sbjct  7    DEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDD 66
Query  82   HPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEED 141
            +  R+P+Q  E+ + + E+ R         R+ E+  Q+EE+E  R  +++  +      
Sbjct  67   QNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRC 126
Query  142  EDE---DEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNK--NPF 196
            +      E+  ERQ    R  +Q+ ER  +E +  E+  E+    +S  R  + +  NP+
Sbjct  127  QRRCQIQEQSPERQ----RQCQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPY 182
Query  197  LFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYL 256
             F S    +  +++ G ++ L+RF +R+  L+ + +YR++ +++ PNT +LP+H DA+ +
Sbjct  183  YFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESV 242
Query  257  IVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKP 316
             V+  G A L+LV+ + R+S+ L+ GD +RVP+G T YV+N D+NE L ++ L  PVN P
Sbjct  243  AVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNP 302
Query  317  GRFESFFLSSTEA-QQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESV 375
            G+F  ++ +  ++  QSYL+ FS +IL A+ +T  + + + +        Q EQR  E V
Sbjct  303  GQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF-------DQQEQR--EGV 353
Query  376  IVEISKEQIRALSKRAKSSSRKTIS--SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQL 433
            I+  S+E++RALS+ A S+ ++     S   P +L+S  P YSN++G+FFE  PE++ QL
Sbjct  354  IIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQL 413
Query  434  RDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ--------EQQ 485
            +++D++++  ++  GA+++PH+NSKA V++ + EG    E+       Q        EQ+
Sbjct  414  QEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQE 473
Query  486  QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAGSQ 543
            +EE     +K  A L+  DIFVIPAG+P+ + A+ N N+  +G  IN ENNQR+FLAG Q
Sbjct  474  EEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-Q 532
Query  544  DNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILR- 602
            +N+I+Q+  + +EL+F    + +E+++++Q ESYFV  + ++   G +GR  PL+SIL  
Sbjct  533  NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQSRRG-QGRDHPLASILDF 590
Query  603  AFY 605
            AF+
Sbjct  591  AFF 593

Sequence Alignment: 13. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 147.9 bits 1140,  Expect = 1e-36
 Identities = 229/399 57%, Positives = 332/399 83%, Gaps = 15/399 3%
Query  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
            R   +NPF+F SNRF+TL++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP+TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
             + DAD+++V+L+G A L+++ ++DR+S+ L+ GDA+++P+GT  Y+ N D+NE+LR++ 
Sbjct  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLD 121
Query  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
            LAIPVNKPG+++SF+LS T+ Q S L GFS+NILEA+++T +EEI KVL+ ++E + Q  
Sbjct  122  LAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  369  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
            + L+        E+VIV++S+EQI  LSK AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
Query  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
            KFFEITPEKN QL+DLDIF++ VD+ EG+LLLP++NS+AIVI+ + EG  + ELVG + +
Sbjct  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
Query  481  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 533
             Q       E+Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN+   GINAEN
Sbjct  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
Query  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587
            N+RNFLAG +DNVISQ+   V+ELAFPGS++ V++LLKNQ++SYF +AQP ++E
Sbjct  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 14. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 145.9 bits 1123,  Expect = 5e-36
 Identities = 227/399 56%, Positives = 328/399 82%, Gaps = 15/399 3%
Query  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
            R   +NPF+F SNRF+TL++N+ G IR+LQ+F++RS  ++NL++YR+LE+ SKP TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLP 61
Query  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
               DAD+++V+L+G A L+++ ++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  62   QCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
Query  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
            L IPVNKPG+++SF+LS T+ Q S L GFS+NILEA+++T +EEI KVL+ ++E + Q  
Sbjct  122  LTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHR 181
Query  369  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
            + L+        E+VIV++S+EQI  LSK AKSSS+K++SSE  PFNLRSR+PIYSNK+G
Sbjct  182  RSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFG 241
Query  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQ 480
            KFFEITPEKN QL+DLDIF++ VD+ EG+LLLP++NS+AIVI+ + EG  + ELVG + +
Sbjct  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE 301
Query  481  QQ-------EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAEN 533
             Q       E+Q+EE   +V+ YRA+LS  D+FVIPAG+PV +NA+S+LN+   GINAEN
Sbjct  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAEN 361
Query  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587
            N+RNFLAG +DNVISQ+   V+ELAFPGS++ V++LLKNQ++SYF +AQP ++E
Sbjct  362  NERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 15. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 140.9 bits 1082,  Expect = 3e-34
 Identities = 200/553 36%, Positives = 358/553 64%, Gaps = 51/553 9%
Query  29   EKENPK-----HNKCLQSCNSERDSYRNQA-CHARCNL-LKVEKEECEEGEIPRPRPRPQ 81
            ++ENP+     + +C + C  +    R Q  C++RC   L+ E+ + EE E  R R    
Sbjct  203  DEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQEERERRRGRDEDD 262
Query  82   HPEREPQQPGEKEEDEDEQPRPIPFPR------PQPRQEEEHEQ---REEQEWPRKEEKR 132
            +  R+P+Q  E+ + + E+ R     +       Q RQ+EE E+   R+ Q+ P+++  R
Sbjct  263  QNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQRQQEERERQRGRDRQD-PQQQYHR 321
Query  133  GEKGSEEEDEDEDEEQDERQFPFPRPPHQ-KEERNEEEDEDEEQQRESEESEDSELRRHK 191
             ++  + +++  + ++  +Q    R   Q KE++  E   D+   R      + E +RH 
Sbjct  322  CQRRCQTQEQSPERQRQCQQ----RCERQYKEQQGREWGPDQASPRRESRGREEEQQRH- 376
Query  192  NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHA 251
              NP+ F S  + +  ++  G ++ L+RF +R+  L+ + +YR++ + + PNT++LP H 
Sbjct  377  --NPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHK 434
Query  252  DADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAI 311
            DA+ +IV+  G A L++V+ + R+S+ L+ GD +RVP+G T YV+N D+NE L ++ L  
Sbjct  435  DAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQ 494
Query  312  PVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRL 371
            PVN PG+F  ++ +  ++ +SYL+ FS +IL A+ +T  + + + +        Q EQR 
Sbjct  495  PVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFF-------DQQEQR- 546
Query  372  QESVIVEISKEQIRALSKRAKSSSRKTIS--SEDKPFNLRSRDPIYSNKLGKFFEITPEK 429
             E VI+  S+E++RALS+ A S+ ++     S   P +L+S+   YSN++G+FFE  PE+
Sbjct  547  -EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEE 605
Query  430  NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV---GLKEQ------ 480
            + QL+++D++++  ++  GA+++PH+NSKA V++ + EG    E+     +  Q      
Sbjct  606  HRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKG 665
Query  481  QQEQQQEEQPL-EVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRN 537
            ++EQ++EE    + +K  A L+  DIFVIPAG+P+ + A+ N N+  +G  IN +NNQRN
Sbjct  666  RREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRN 725
Query  538  FLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPL 597
            FLAG Q+N+I+Q+  + +EL+F    + +E++++ Q ESYFV  + ++   G +GR  PL
Sbjct  726  FLAG-QNNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPME-RQSRRG-QGRDHPL 782
Query  598  SSIL 601
            +SIL
Sbjct  783  ASIL 786

Sequence Alignment: 16. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 138.5 bits 1061,  Expect = 9e-34
 Identities = 177/465 38%, Positives = 317/465 68%, Gaps = 36/465 7%
Query  120  REEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQ-KEERNEEEDEDEEQQRE 178
            R+ Q+ P+++  R ++  + +++  + ++  +Q    R   Q KE++  E   +   +RE
Sbjct  2    RDRQD-PQQQYHRCQRRCQIQEQSPERQRQCQQ----RCERQYKEQQGRERGPEASPRRE 56
Query  179  SEESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEF 238
            S+  E+ E +RH   NP+ F S    +  +++ G ++ L+RF +R+  L+ + +YR++ +
Sbjct  57   SKGREE-EQQRH---NPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVIL 112
Query  239  NSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNP 298
            ++ PNT++LP+H DA+ +IV+  G A L+LV+ + R+S+ L+ GD +RVP+G T YV+N 
Sbjct  113  DANPNTFMLPHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQ 172
Query  299  DNNENLRLITLAIPVNKPGRFESFFLSSTEA-QQSYLQGFSRNILEASYDTKFEEINKVL 357
            D+NE L ++ L  PVN PG+   ++ +  ++  QSYL+ FS +IL A+ +T  + + + +
Sbjct  173  DSNERLEMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF 232
Query  358  FSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS--SEDKPFNLRSRDPIY 415
                    Q EQR  E VI+  S+E++RALS+ A S+ ++     S   P +L+S  P Y
Sbjct  233  -------DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSY 283
Query  416  SNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV 475
            SN++G+FFE  PE++ QL+++D++++  ++  GA+++PH+NSKA V++ + EG    E+ 
Sbjct  284  SNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMA 343
Query  476  -------GLKEQ-QQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF--F 525
                    +++Q ++EQ++EE     +K  A L+  DIFVIPAG+P+ + A+ N N+  +
Sbjct  344  CPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLL 403
Query  526  AIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKK 585
              GIN ENNQRNFLAG Q+++I+Q+  + +EL+F    + +E+++++Q ESYFV  + ++
Sbjct  404  GFGINGENNQRNFLAG-QNSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQ 461
Query  586  KEEGNKGRKGPLSSILR-AFY 605
               G +GR  PL+SIL  AF+
Sbjct  462  SRRG-QGRDHPLASILGFAFF 481

Sequence Alignment: 17. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 134.5 bits 1027,  Expect = 2e-32
 Identities = 193/555 34%, Positives = 346/555 62%, Gaps = 55/555 9%
Query  27   YWEKENPKHN--KCLQSCNSERDSYRNQA-CHARCNLLKVEKEECEEGEIPRPRPRPQHP 83
            Y  +++P+ +  +C + C  +    R Q  C+ RC      KE CEE E      R + P
Sbjct  72   YDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRC------KEICEEEE---EYNRQRDP 122
Query  84   EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED 143
            +++ +Q  E+ +  + +PR +   + +  +  E E+R++Q+   ++++  E+  EE  ++
Sbjct  123  QQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKE 182
Query  144  EDEEQDERQFPFP---RPPHQKEERNEEEDEDE--EQQRESEESED------------SE 186
            ED ++D +Q  +    R   Q+E R + + +    EQQR+     D             E
Sbjct  183  EDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYEE 242
Query  187  LRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLL 246
                ++ NP+ F    + T F+ + G I VL+ F  RS  L+ L++YR++ + + PN ++
Sbjct  243  GEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFV 302
Query  247  LPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRL 306
            LP H DAD ++++  G   L +++ D+R+SY L+ GD +R+P+GTT+Y++N DNNE L +
Sbjct  303  LPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHI 362
Query  307  ITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQ 366
              +   ++ PG+++ FF +  +  + YL  FS+ ILEA+ +T+ E +  VL         
Sbjct  363  AKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL--------- 413
Query  367  GEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS----SEDKPFNLRSRDPIYSNKLGKF 422
            G+QR  E VI+  S+EQIR L++    S R  I     S   P+NL ++ P+YSNK G+ 
Sbjct  414  GQQR--EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQA 471
Query  423  FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV-----GL 477
            +E+ PE   QL+D+D+ + I ++ +G+++ P FN+++  ++V+  G+A++E+      G 
Sbjct  472  YEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGR 531
Query  478  KEQQQ--EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF--FAIGINAEN 533
               ++  ++++EE+ +   + +A LS+++  V+P G+PVV  ++ N N+  FA GINA+N
Sbjct  532  HGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQN 591
Query  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593
            N+ NFLAG + NV+ QI  Q  ELAF    + VE+L+ +Q ES F     + +++ ++  
Sbjct  592  NHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRST 651
Query  594  KG--PLSSIL 601
            K   PL SIL
Sbjct  652  KQQQPLVSIL 661

Sequence Alignment: 18. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 134.2 bits 1025,  Expect = 2e-32
 Identities = 195/555 35%, Positives = 347/555 62%, Gaps = 55/555 9%
Query  27   YWEKENPKHN--KCLQSC-NSERDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHP 83
            Y  +E+P+    +C + C   E D  + Q C+ RC      KE CEE E      R + P
Sbjct  31   YDNQEDPQTECQQCQRRCRQQESDPRQQQYCQRRC------KEICEEEE---EYNRQRDP 81
Query  84   EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED 143
            +++ +Q  ++ +  + +PR +   + +  +  E E+R++Q+   ++++  E+  EE  ++
Sbjct  82   QQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKE 141
Query  144  EDEEQDERQFPFP---RPPHQKEERNEEEDED--EEQQRESEESED------------SE 186
             D ++D +Q  +    R   Q+E R + + +   +EQQR+     D             E
Sbjct  142  GDNKRDPQQREYEDCRRHCEQQEPRLQYQCQRRCQEQQRQHGRGGDLMNPQRGGSGRYEE 201
Query  187  LRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLL 246
                ++ NP+ F    + T F+ + G I VL+ F  RS  L+ L++YR++ + + PN ++
Sbjct  202  GEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFV 261
Query  247  LPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRL 306
            LP H DAD +++++ G   L +++ D+R+SY L+ GD +R+P+GTT+Y++N DNNE L +
Sbjct  262  LPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHI 321
Query  307  ITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQ 366
              +   ++ PG+++ FF +  +  + YL  FS+ ILEA+ +T+ E +  VL         
Sbjct  322  AKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL--------- 372
Query  367  GEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS----SEDKPFNLRSRDPIYSNKLGKF 422
            G+QR  E VI+  S+EQIR L++    S R  I     S   P+NL ++ P+YSNK G+ 
Sbjct  373  GQQR--EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQA 430
Query  423  FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV--GLKEQ 480
            +E+ PE   QL+D+D+ + I ++ +G+++ P FN+++  ++V+  G+A++E+    L  +
Sbjct  431  YEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGR 490
Query  481  QQ-----EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF--FAIGINAEN 533
            +      ++++EE+ +   + RA LS+++  V+ AG+PVV  ++ N N+  FA GINA+N
Sbjct  491  HGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQN 550
Query  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593
            N+ NFLAG + NV+ QI  Q  ELAF  S + VE+L+ +Q ES F     + +++  +  
Sbjct  551  NHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPRQHQQQSPRST 610
Query  594  KG--PLSSIL 601
            K   PL SIL
Sbjct  611  KQQQPLVSIL 620

Sequence Alignment: 19. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 131.0 bits 998,  Expect = 2e-31
 Identities = 204/555 36%, Positives = 347/555 62%, Gaps = 46/555 8%
Query  13   LVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNLL---KVEKEECE 69
            +V+L S+ +SFG+    K+ P           +    R + C  RC      + E+++CE
Sbjct  9    VVLLFSLFLSFGLLCSAKDFPGRR------GDDDPPKRYEDCRRRCEWDTRGQKEQQQCE 62
Query  70   EGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKE 129
            E    +   + Q+    P+ P  + E+  ++ R     R +P+ ++   +R EQE  + +
Sbjct  63   ESCKSQYGEKDQQQRHRPEDPQRRYEECQQECRQ-QEERQRPQCQQRCLKRFEQEQQQSQ 121
Query  130  EKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRR 189
             +  E    ++   + E++ ER+    R   +  ER +E     E++ E+EE E  E  +
Sbjct  122  RQFQEC---QQHCHQQEQRPERKQQCVR---ECRERYQENPWRREREEEAEEEETEEGEQ 175
Query  190  HKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN 249
             ++ NPF F    F++ F+ ++G  RVLQRF  R P L+ + ++R+  + + PNT++LP+
Sbjct  176  EQSHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPH 235
Query  250  HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL 309
            H DA+ + ++ NG   L+++ +++++SY +  G  +RVP+G+T Y+ N DN E L +  L
Sbjct  236  HCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVL 295
Query  310  AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ 369
              PVN P +FE FF + ++  QSYL+ FSR ILE +++T+ E++++ LF    G +Q  +
Sbjct  296  HRPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDE-LF----GGRQSHR 350
Query  370  RLQ-ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPE 428
            R Q + +  + S+EQIRALS+ A S   K  S E   FNL  R P YSN+ G+F+E  P 
Sbjct  351  RQQGQGMFRKASQEQIRALSQEATSPREK--SGERFAFNLLYRTPRYSNQNGRFYEACPR 408
Query  429  KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVG-----------L 477
            +  QL D+++ +S + +N+G++++PH+NSKA  ++++NEG+  +E+V             
Sbjct  409  EFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEE 468
Query  478  KEQQQEQQQEEQ--PLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG------- 528
            +EQQQEQ+QEE+    + RK R++LS  DIFV+PA +PV   A+ N N+   G       
Sbjct  469  EEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQN 528
Query  529  INAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQ-RESYFVDAQPKKKE 587
            IN ++NQR F+AG + N + Q  SQ +ELAF  S++ V++++ N  +ESYFV  Q ++  
Sbjct  529  INPDHNQRIFVAG-KINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQRQRAS 587
Query  588  E 588
            E
Sbjct  588  E 588

Sequence Alignment: 20. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 125.5 bits 951,  Expect = 1e-29
 Identities = 201/565 35%, Positives = 355/565 62%, Gaps = 50/565 8%
Query  13   LVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERD-SYRNQACHARCNLL---KVEKEEC 68
            +V+L S+ +SFG+    K+ P          SE D   R + C  RC L    + E+++C
Sbjct  9    VVLLFSLFLSFGLLCSAKDFPGRR-------SEDDPQQRYEDCRKRCQLETRGQTEQDKC 61
Query  69   EEGEIPRPRPRPQHPEREPQQPGE--KEEDEDEQPRPIPFPRPQPRQE-EEHEQREEQEW 125
            E+    + +   Q    +PQ+  +  ++  + E+ R     RP+  Q   E+ ++++Q+ 
Sbjct  62   EDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRL----RPHCEQSCREQYEKQQQQQ 117
Query  126  PRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDS 185
            P K+ K  ++  + +     E++ ER+    +   ++ + +  + E E + RE EE E  
Sbjct  118  PDKQFKECQQRCQWQ-----EQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESD 172
Query  186  ELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTL 245
            E  +++  NP+ F    F+  F+ ++G  RVLQRF  +   L+ + ++RI  + + PNT+
Sbjct  173  EGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTF 232
Query  246  LLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLR 305
            +LP+H DA+ + V+ NG   +++V +++++SY +  G  +R+P+G+T Y+ N DN E L 
Sbjct  233  VLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLT 292
Query  306  LITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQ 365
            +  L  PVN PG+F+ FF +  E  QSYL+ FSR ILEA ++T+ E+++++      G +
Sbjct  293  IAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDEL-----PGGR 347
Query  366  QGEQRLQ-ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFE 424
            Q  +R Q + +  + S+EQIRALS+ A S   K   SE   FNL S+ P YSN+ G+F+E
Sbjct  348  QSHRRQQGQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSNQNGRFYE 405
Query  425  ITPEK-NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV--GLKEQ- 480
              P     QLR++D  +   ++N+G++++PH+NSKA  ++++ EG+ ++E+V   L  Q 
Sbjct  406  ACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQS 465
Query  481  -----QQEQQQEEQPLEVR-----KYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIG 528
                 ++E++QEEQ +E R     + RA+LS  ++FV+PAG+PV   A+ N  L ++  G
Sbjct  466  SDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFG 525
Query  529  I-NAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQ-RESYFVDAQPKKK 586
            + N ++N+R F+AG  +NV  Q   Q +ELAF   ++ V++++ N  +ESYFV  + ++ 
Sbjct  526  LYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRG 584
Query  587  EEGNKGRKGPLSSIL 601
             +  +G   PLS  L
Sbjct  585  FDERRGSNNPLSPFL 599

Sequence Alignment: 21. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 100.3 bits 738,  Expect = 4e-22
 Identities = 289/576 50%, Positives = 403/576 69%, Gaps = 76/576 13%
Query  2    MRARF-PL-LLLGLVFLASVSVSFGIA--YWEK-ENPKHNKCLQSCNSERDSYRNQACHA 56
            MR R  PL LLLG++ LASVS +   +  Y +K ENP   +CLQSC  E D  + +AC +
Sbjct  1    MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEPDDLKQKACES 60
Query  57   RCNLLKVEKEECEEGEIPRPRPRPQHP-EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEE 115
            RC  L+ +   C    +  PR       +R P  PGE+      QP      R QPR+EE
Sbjct  61   RCTKLEYDPR-C----VYDPRGHTGTTNQRSP--PGERTRG--RQPGDYDDDRRQPRREE 111
Query  116  EHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQ 175
                     W       G  G  E + +ED  Q    +   RP HQ+  +   E  + EQ
Sbjct  112  G------GRW-------GPAGPREREREEDWRQPREDW--RRPSHQQPRKIRPEGREGEQ 156
Query  176  QRESEESEDSELRRHKNKN-PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 234
            +  +     S +R   ++N PF F S RF T + NQ GRIRVLQRF+QRS Q+QNL+++R
Sbjct  157  EWGTP---GSHVREETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHR 213
Query  235  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 294
            I++  +KPNTL+LP HADAD ++VI  G A +++ N ++R S+ L  G ALR+PSG   Y
Sbjct  214  IVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISY 273
Query  295  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 354
            ++N  +N+NLR+  +++PVN PG+FE FF +S+  Q SYLQGFSRN LEA+++ +F EI 
Sbjct  274  ILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIR 333
Query  355  KVLFSREEGQQQ---GEQRLQ-------ESVIVEISKEQIRALSKRAKSSSRKTISSED- 403
            +VL+    G +Q   G++R         E VIV++SKE++  L+K AKS S+K    E  
Sbjct  334  RVLLEENAGGEQEERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGD 393
Query  404  --KPFNLRSRDPIYSNKLGKFFEITPEK-NPQLRDLDIFLSIVDMNEGALLLPHFNSKAI 460
               P NLR  +P  SN +GK+FE+ P+K NPQL+DLD+ L+ V++ EGAL+LPHFNSKA+
Sbjct  394  ITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAM 453
Query  461  VILVINEGDANIELVGL-KEQQQEQQQEEQP----------LEVRKYRAELSEQDIFVIP 509
            VI+V+N+G  N+ELV + KEQQQ  ++EE+            EVR+Y A L E D+F++P
Sbjct  454  VIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMP 513
Query  510  AGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKL 569
            A +PV +NA+S L+++  GINAENN+R FLAG +DNVI QI  Q ++LAFPGS + VEKL
Sbjct  514  AAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKL 573
Query  570  LKNQRESYFVDAQPKKK-----------------EEGNKGRKGPLSSILRAF 604
            +KNQ+ES+FV A+P+ +                 EE N+G KGPL SIL+AF
Sbjct  574  IKNQKESHFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPLLSILKAF 625

Sequence Alignment: 22. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 99.8 bits 734,  Expect = 5e-22
 Identities = 290/573 50%, Positives = 406/573 70%, Gaps = 70/573 12%
Query  2    MRARF-PL-LLLGLVFLASVSVSFGIAYWEK-ENPKHNKCLQSCNSERDSYRNQACHARC 58
            MR R  PL LLLG++ LASVS +   + + K ENP   +CLQSC  E D  + +AC +RC
Sbjct  1    MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDDLKQKACESRC 60
Query  59   NLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHE 118
              L+ +   C        +  P       +QPG+ ++D           R QPR+EE   
Sbjct  61   TKLEYDPR-CVYDTGATNQRHPPGERTRGRQPGDYDDD-----------RRQPRREEG-- 106
Query  119  QREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRE 178
                  W   E +  E+   EED  +  E D R     RP HQ+  +   E  + EQ+  
Sbjct  107  ----GRWGPAEPRERER---EEDWRQPRE-DWR-----RPSHQQPRKIRPEGREGEQEWG 153
Query  179  SEESEDSELRRHKNKN-PFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILE 237
            +     SE+R   ++N PF F S RF T + NQ GRIRVLQRF+QRS Q+QNL+++RI++
Sbjct  154  TP---GSEVREETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQ 210
Query  238  FNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVN 297
              ++PNTL+LP HADAD ++VI  G A +++ N ++R S+ L  G ALR+PSG   Y++N
Sbjct  211  IEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILN 270
Query  298  PDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVL 357
              +N+NLR+  +++PVN PG+FE FF +S+  Q SYLQGFSRN LEA+++ +F EI +VL
Sbjct  271  RHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVL 330
Query  358  FSREEGQQQGE--QRLQ-------ESVIVEISKEQIRALSKRAKSSSRKTISSED--KPF 406
            +    G +Q E  QR +       E VIV++SKE+++ L+K AKS S+K    ED   P 
Sbjct  331  LEENAGGEQEERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPI 390
Query  407  NLRSRDPIYSNKLGKFFEITPEK-NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVI 465
            NLR  +P  SN +G++FE+ P+K NPQL+DLD+ L+ V++ EGAL+LPHFNSKA+VI+V+
Sbjct  391  NLRDGEPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVV 450
Query  466  NEGDANIELVGL-KEQQQ----EQQQEEQPL---------EVRKYRAELSEQDIFVIPAG 511
            N+G  N+ELV + KEQQQ    EQ+ EE+           EVR+Y A L E D+F++PA 
Sbjct  451  NKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAA 510
Query  512  YPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLK 571
            +PV +NA+S L+++  GINAENN+R FLAG +DNVI QI  Q ++LAFPGS + VEKL+K
Sbjct  511  HPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIK 570
Query  572  NQRESYFVDAQPKKK----------EEGNKGRKGPLSSILRAF 604
            NQRES+FV A+P+ +          EE N+G KGPL SIL+AF
Sbjct  571  NQRESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSILKAF 613

Sequence Alignment: 23. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 92.4 bits 671,  Expect = 9e-20
 Identities = 191/550 34%, Positives = 337/550 61%, Gaps = 61/550 11%
Query  5    RFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNLLKVE 64
            R+ L+L+ L++ ++V  S      E ++P+  +C           ++Q C A+  + K +
Sbjct  6    RLCLVLFALLLASAVVAS------ESKDPELKQC-----------KHQ-CKAQQQISKEQ 47
Query  65   KEECEEGEIPRPRPRPQHPEREPQQPGEKEEDED-EQPRPIPFPRPQPRQ-EEEH-EQRE 121
            KE C +    +   R +H     +  G+  E+E   +  PI   R   R  E++H EQRE
Sbjct  48   KEACIQAC--KEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQHGEQRE 105
Query  122  EQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFP--RP------PHQKEERNEEEDEDE 173
            E     +EE + EKG +++D   D E+  +Q  +   R         +  ER  EE   E
Sbjct  106  ECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGFSREHCERRREEKYRE 165
Query  174  EQQRES--------EESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSP 225
            +Q RE          E E+ +  + + + P++F    F T F+ Q+GR+RVLQ+F  RS 
Sbjct  166  QQGREGGRGEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSE 225
Query  226  QLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDAL 285
             L+ + +YR+  + ++P T+++PNH DA+ ++ +  G   +SLV  D R+S  ++ GD L
Sbjct  226  LLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDIL 285
Query  286  RVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEAS 345
            ++ +GTT Y++N DNNE L L  L  PV+ PG FE FF +  E  +S+++ FS  ILEA+
Sbjct  286  KINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAA 345
Query  346  YDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDK- 404
            ++T+ + + +++         G+QR  + VIV+ S+EQ+RA+S R +         E K 
Sbjct  346  FNTRRDRLQRIF---------GQQR--QGVIVKASEEQVRAMS-RHEEGGIWPFGGESKG 393
Query  405  PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILV 464
              N+  + P +SN+ G++ E+   +  QLRDLD+ +S+ ++ +GA+  PH+NSKA  I +
Sbjct  394  TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIAL 453
Query  465  INEGDANIELV--GLKEQQQEQQQEEQ--PLEVRKYRAELSEQDIFVIPAGYPVVVNATS 520
            + +G+   E+    +   +   Q E +  P   ++  + L+   + +IPAG+P V  A+S
Sbjct  454  VVDGEGYFEMACPHMSRSRGSYQGETRGRP-SYQRVASRLTRGTVVIIPAGHPFVAVASS 512
Query  521  NLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYF 578
            N N+  +   +NA NN++  LAG + NV++Q+  + +ELAF   A+ VE++ ++Q+E +F
Sbjct  513  NQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFF 571
Query  579  VDAQPKKKEEG 589
                P+++++G
Sbjct  572  FKG-PRQQQQG 581

Sequence Alignment: 24. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 85.9 bits 616,  Expect = 7e-18
 Identities = 158/455 34%, Positives = 272/455 59%, Gaps = 30/455 6%
Query  123  QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEES 182
            Q+   K+ K   +   + DE E +E+ +R         +  ER E    +E   RE E  
Sbjct  29   QDPELKQCKHQCRHQRQFDEQE-KEHCQRSCDEYHIEKKARERAERRRSEEGSSRE-EGY 86
Query  183  EDSELR-RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSK 241
            E+ EL    + +NP++F    FET  +   GRI+VL++F +RS  L+ + ++R+  + + 
Sbjct  87   EEEELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEAN 146
Query  242  PNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNN 301
            P T++ P H DA+ ++ +  G A ++ V  + R+++ ++ GD +R+P+GT  Y++N D N
Sbjct  147  PQTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDEN 206
Query  302  ENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSRE 361
            E L ++ +  PV+ PG FE+F  S  E  +S+ + FS  +LEA+  T+ +++ K LF + 
Sbjct  207  EKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEK-LFGK- 264
Query  362  EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDK--PFNLRSRDPIYSNKL 419
              Q QG       VI++ SKEQIR++SK  +++ R      D   PFNL  + P  SN++
Sbjct  265  --QTQG-------VIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQF 315
Query  420  GKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV--GL 477
            G++FE  P++  QL+DLD+ +S  ++ +G++  P++NS+A  I V+ EG+   E+    L
Sbjct  316  GRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHL 375
Query  478  KEQQQEQQQEEQPLEVRKYRAELSEQDI---------FVIPAGYPVVVNATSNLNF--FA 526
                   Q+E      R+ R+  S Q I         FV PAG+PV V A+ N N+  + 
Sbjct  376  SSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLC 435
Query  527  IGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKK 586
              +NA+ N R  LAG ++N++++   + +ELAF   A+ VEK+++NQ + +F     ++ 
Sbjct  436  FDVNAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQP 494
Query  587  EEGNK 591
            EEG +
Sbjct  495  EEGGR 499

Sequence Alignment: 25. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 81.5 bits 579,  Expect = 1e-16
 Identities = 157/484 32%, Positives = 274/484 56%, Gaps = 29/484 5%
Query  94   EEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQF 153
            +E++ EQ         + ++  E+E+ EE+EW      RG++ S  E  ++   Q  +Q 
Sbjct  20   DEEQKEQCAKGCEKYYKEKKGREQEEEEEEEWG-SGRGRGDEFSTHEPGEKRLSQCMKQC 78
Query  154  PFPRPPHQKE-------ERNEEEDEDEEQQR-ESEESEDSELRRHKNKNPFLFGSNRFET 205
                  +QK+       E+ ++E  +    R E EE E  E +  +++NP++F    F T
Sbjct  79   ERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDEEQEEEDENPYVFEDEHFTT 138
Query  206  LFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAI 265
              K + G++ VL +F +RS  L+ L  YR+  + + P  +++PNH DAD +  +  G   
Sbjct  139  RVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGT 198
Query  266  LSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLS 325
            ++ +  + R+S  ++ GD +R+ +GT +Y+VN D NE L ++ L  PVN PG +E F   
Sbjct  199  ITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVNLPGHYEVFHGP 258
Query  326  STEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR 385
              E  +S+ + FSR +LEA+  T  +++ K++  ++EG            IV+ SKEQIR
Sbjct  259  GGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEG-----------AIVKASKEQIR 307
Query  386  ALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVD 444
            A+S+R +  S    + +    FNL  +DP  SN  G++FE   +  P L++LDI +S V+
Sbjct  308  AMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQELDIMVSYVN 367
Query  445  MNEGALLLPHFNSKAIVILVINEGDANIELV--GLKEQQQEQQQEEQPLEVRKYRAELSE 502
            + +G +  P +NS+A  I ++  G+  +E+    L   +   Q++  P   +K  + +  
Sbjct  368  ITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGP-SYKKLSSSIRT 426
Query  503  QDIFVIPAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 560
              +FV+PAG+P V  A+ N N+  +   +NAE N R  LAG + N+I  +  + +ELAF 
Sbjct  427  DSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKK-NIIEVMEKEAKELAFK 485
Query  561  GSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593
               + V+K++  Q E +F    PK ++   +GR
Sbjct  486  TKGEEVDKVFGKQDEEFFFQG-PKWRQH-QQGR 516

Sequence Alignment: 26. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 70.4 bits 485,  Expect = 3e-13
 Identities = 117/385 30%, Positives = 222/385 57%, Gaps = 24/385 6%
Query  191  KNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH 250
            + +NP++F S+RF     ++ G IR L  F + S  L+ +  YR+     KPNT++LP++
Sbjct  62   REENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY 121
Query  251  ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLA 310
             DA +++ +  G   ++ V  ++    +L+ GD + VPSG T+Y+VN D++ +LR+ +L 
Sbjct  122  IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLL 181
Query  311  -IPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ 369
                   G +E F+++     ++    FS ++LEA+++T  +++  ++ +   G      
Sbjct  182  RTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRG------ 235
Query  370  RLQESVIVEISKEQIRALSKRAKSSSRKTISSED-KPFNLRSRDPIYSNKLGKFFEITPE 428
                 VI   ++EQIR + +R   S+  T +SE  KPFNLR++ P + N  G+F    P+
Sbjct  236  -----VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPK 290
Query  429  KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE----- 483
             NP L  +D+ +    +N G +  P  N+KA  I ++ EG+  IE+      Q+      
Sbjct  291  DNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP 350
Query  484  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAG 541
            +++  Q +   + RA L    ++V+PAG+P+   A++N  L  +   IN   N+R FLAG
Sbjct  351  RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG 410
Query  542  SQDNVISQIPSQVQELAF--PGSAQAVEKLLKNQRESYFVDAQPKKKEE 588
             ++NV+  +  +V+ L+F  P   + +E++L+ Q++   +    +++ +
Sbjct  411  -KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQRRD 457

Sequence Alignment: 27. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 69.4 bits 476,  Expect = 6e-13
 Identities = 146/421 34%, Positives = 257/421 61%, Gaps = 30/421 7%
Query  148  QDERQFPFPRPPHQKEERNE--EEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFET 205
            +DERQF      +Q+ +  +  EE   E QQ E   SE+S   + + +NP++F    FE+
Sbjct  17   RDERQFD----EQQRRDGKQICEEKARERQQEEGNSSEES-YGKEQEENPYVFQDEHFES 71
Query  206  LFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAI 265
              K + GR++VL+ F +RS  L  + ++R+  + + P+T++ P H DA+ ++ +  G A 
Sbjct  72   RVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRAT 131
Query  266  LSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLS 325
            +++V  + R+S+ ++ GD +R+P+GT  Y++N D NE L ++ +  PV+ PG FE+F+ +
Sbjct  132  ITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGA 191
Query  326  STEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR 385
              E  +S+ + FS  +LEA+   + E++ KV+         GEQ   +  IV+ S+E+IR
Sbjct  192  GGEDPESFYRAFSWEVLEAALKVRREQLEKVF---------GEQ--SKGSIVKASREKIR 240
Query  386  ALSKRAKSSSRK-TISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIV 443
            ALS+  +   R      E   P NL  + P  SN++G+++E  P+ + QL+DLD+ +S  
Sbjct  241  ALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFA 300
Query  444  DMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQ 503
            ++ +G++  P++NS+A  I V+ EG+   E+            +       K  A L   
Sbjct  301  NITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ-------KISARLRRG 353
Query  504  DIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPG 561
             +FV PAG+PV V A+  +NL  +   +NA  N R  LAG + N++++     +ELAF  
Sbjct  354  VVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVNEFERDAKELAFNL 412
Query  562  SAQAVEKLLKNQRESYFVDAQPKKKEEGNKG 592
             ++ VE+++KNQ +++F     K++EEG +G
Sbjct  413  PSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443

Sequence Alignment: 28. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 67.6 bits 461,  Expect = 2e-12
 Identities = 158/488 32%, Positives = 273/488 55%, Gaps = 44/488 9%
Query  80   PQHPEREPQQPGEKEEDEDEQPRPIP----FPRPQPRQEEEHEQREEQEWPRKEEKRGEK 135
            P+  + + Q   +++ DE ++ + +     + + +  +E EHE+ EE+EW       G  
Sbjct  28   PELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEE-EEEEW-------GTG 79
Query  136  GSEEEDEDEDEE----QDERQFPFPRPPHQKE-------ERNEEEDEDEEQQRESEESED 184
            G +E    E  E    Q  RQ       +QK+       ER ++E      +RE +E ED
Sbjct  80   GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDED 139
Query  185  SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNT 244
             +    +++NP++F    F T  K + G++ +L +F Q+S  L+ L  YR+  + + P  
Sbjct  140  EDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA 199
Query  245  LLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENL 304
            +++P+H DAD +  +  G   ++ +  + R+S  ++ GD + + SGT +Y+ N D NE L
Sbjct  200  FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKL 259
Query  305  RLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQ 364
             L+ +  PVN PG FE F     E  +S+ + FS  ILEA+  T  + + K LF   E Q
Sbjct  260  YLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQ 315
Query  365  QQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFF 423
             QG        I++ SKEQ+RA+S+R +       + E    F L  +DP  SNK G++F
Sbjct  316  DQG-------TIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLF 368
Query  424  EITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE 483
            E      P L  LD+ +S  ++ +G + +P +NS+A  I ++  G+  +E+      +  
Sbjct  369  EAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC---PHLS 425
Query  484  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAG 541
              +  +P   +K RA + +  +F++PAG+P    A+ N N+  +   +NAE N R  LAG
Sbjct  426  SSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAG 484
Query  542  SQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593
             + N+I  +  + +ELAF    + V+K++  Q E +F      +KE+  +GR
Sbjct  485  KK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 533

Sequence Alignment: 29. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 67.6 bits 461,  Expect = 2e-12
 Identities = 159/488 32%, Positives = 273/488 55%, Gaps = 44/488 9%
Query  80   PQHPEREPQQPGEKEEDEDEQPRPIP----FPRPQPRQEEEHEQREEQEWPRKEEKRGEK 135
            P+  + + Q   +++ DE ++ + +     + + +  +E EHE+ EE+EW       G  
Sbjct  30   PELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEE-EEEEW-------GTG 81
Query  136  GSEEEDEDEDEE----QDERQFPFPRPPHQKE-------ERNEEEDEDEEQQRESEESED 184
            G +E    E  E    Q  RQ       +QK+       ER ++E      +RE +E ED
Sbjct  82   GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDED 141
Query  185  SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNT 244
             +    +++NP++F    F T  K + G++ +L +F Q+S  L+ L  YR+  + + P  
Sbjct  142  EDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA 201
Query  245  LLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENL 304
            +++P+H DAD +  +  G   ++ +  + R+S  ++ GD + + SGT +Y+ N D NE L
Sbjct  202  FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKL 261
Query  305  RLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQ 364
             L+ +  PVN PG FE F     E  +S+ + FS  ILEA+  T  + + K LF   E Q
Sbjct  262  YLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQ 317
Query  365  QQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFF 423
             QG        I++ SKEQIRA+S+R +       + E    F L  +DP  SNK G++F
Sbjct  318  DQG-------TIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLF 370
Query  424  EITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE 483
            E      P L  LD+ +S  ++ +G + +P +NS+A  I ++  G+  +E+      +  
Sbjct  371  EAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC---PHLS 427
Query  484  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAG 541
              +  +P   +K RA + +  +F++PAG+P    A+ N N+  +   +NAE N R  LAG
Sbjct  428  SSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAG 486
Query  542  SQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593
             + N+I  +  + +ELAF    + V+K++  Q E +F      +KE+  +GR
Sbjct  487  KK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 535

Sequence Alignment: 30. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 43.2 bits 255,  Expect = 5e-05
 Identities = 107/402 26%, Positives = 201/402 50%, Gaps = 58/402 14%
Query  184  DSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPN 243
            D E    K+   +++ SN    +FK   G +RVL+    R       R   I   + +P 
Sbjct  24   DDEGGDKKSPKSLFLMSNS-TRVFKTDAGEMRVLKSHGGRI----FYRHMHIGFISMEPK 78
Query  244  TLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNEN 303
            +L++P + D++ +I I  G A L ++ +D+    RL++GD   +PSG+ +Y+VN    + 
Sbjct  79   SLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQR 138
Query  304  LRLITLAIPVNKPG--RFESFFLSSTEAQQSYLQGFSRNILEASYD---TKFEEI----- 353
            L +I    P    G   F+SF++      +S L GF   ILE +++   T  EEI     
Sbjct  139  LHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKEL 198
Query  354  -NKVLF----------------SREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSR 396
               ++F                 +++ +QQ ++ +Q+    E  K+  R+  K  ++   
Sbjct  199  DGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFG 258
Query  397  KT---ISSED---KP--FNLRS-RDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 447
            K    I ++D    P  +NL   +   + N  G    +   + P L + DI + +V ++ 
Sbjct  259  KVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSA 318
Query  448  GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 507
            G++L PH N  +    ++  G   +  +G             P   R  + ++ + D+FV
Sbjct  319  GSMLAPHVNPISDEYTIVLSGYGELH-IGY------------PNGSRAMKTKIKQGDVFV 365
Query  508  IPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQA 565
            +P  +P    A+ +  L FF    +A  N+  FLAG+   + + +  ++   AF  S   
Sbjct  366  VPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPELSA-AFGVSEDT 424
Query  566  VEKLLKNQRESYFV-DAQPKKKEEGNKGRKGPLSSILRAF 604
            + + +  Q E+  +  A     E   K +     + +R+F
Sbjct  425  LRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSF 464

Sequence Alignment: 31. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 40.5 bits 232,  Expect = 0.0003
 Identities = 108/400 27%, Positives = 195/400 48%, Gaps = 64/400 16%
Query  176  QRESEESEDSELRRHKNKNPF---LFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRD 232
            Q    E  +  +     ++P    LF   R + ++K   G +R++  +  R     N   
Sbjct  31   QGRGMEGREKRVEEKAPRSPEDRGLFILRRSKEVLKTDAGEVRLMMGYRYRG----NHSP 86
Query  233  YRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTT 292
              I     +PNTL +P + DA  ++ +  G A +  +  +     RL+SG    +P+G++
Sbjct  87   MHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSS 146
Query  293  YYVVNPDNNENLRLI----TLAIPVNKPGRF-ESFFLSSTEAQQSYLQGFSRNILEASYD 347
            +Y+VN D +E L +I    TL   +   G + +SF++      +S L GF  + L A+++
Sbjct  147  FYIVNSDKSERLHIICSIDTLE-SMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFN 205
Query  348  TKFEEINKVLFSREEGQ------QQGEQRLQESVIVEISKEQI----------------- 384
               +++  +L S+  G       +  EQR   S I+++ +  +                 
Sbjct  206  VSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEE 265
Query  385  ------RALSKRAKSSSRKTISSEDK----P--FNLRSRDPIYSNKLGKFFEITPEKNPQ 432
                  R L K         +  + K    P  +NL   +P Y N  G    I       
Sbjct  266  DDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSA 325
Query  433  LRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLE 492
            L+  ++ + +V++  GA+L PH N  A    +I  G   I++V              P  
Sbjct  326  LKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVF-------------PNG 372
Query  493  VRKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAGSQDNVISQI 550
                 A++SE D+F IP  +P    A+    L FF    +A  N+  FL G + +++  +
Sbjct  373  TAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVG-KSSLLHSM 431
Query  551  PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRK 594
                   AF  S + +E+++K QRE+  +   P ++ E   G+K
Sbjct  432  RGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKK 475

Sequence Alignment: 32. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 38.6 bits 216,  Expect = 0.001
 Identities = 83/253 32%, Positives = 136/253 53%, Gaps = 48/253 18%
Query  107  PRPQPRQEE---EHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFP-RPPHQK 162
            P+ Q +Q+E   E E  E+++ P    +R   G  E+DEDEDE++D+   P P RP + K
Sbjct  274  PKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDK---PRPSRPSQGK 330
Query  163  EERN----EEEDEDEEQQRESEE--SEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRV 216
             E++    E+EDEDE+Q R+S E  S+ ++ RR + + P   G      + +N    +++
Sbjct  331  REQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEEN-ICTLKL 389
Query  217  LQRFNQRS-PQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRD 275
             +   + S   + N +  RI  +NS     L   +  A Y+++  NG  I S        
Sbjct  390  HENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNG--IYS-------P 440
Query  276  SYRLQSGDALRVPSGT-TYYVVNPDNN-----ENLRLITLAIPVN-----KPGR--FESF 322
             + L +   + V  G     VVN   N     E  R   L +P N     + G   FE  
Sbjct  441  HWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYI 500
Query  323  -FLSSTEAQQSYLQGFSRNI----LEASYDTKFEEINKVLFSREEG------QQQGEQRL 371
             F +   A  SYL+   R I    L  SY+ +  +++++ +    G       QQG  R+
Sbjct  501  VFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRV 560
Query  372  Q 372
            +
Sbjct  561  K 561

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.