The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL
LKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK
EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED
QDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS
QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA
LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLS
STQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIR
ELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRNPQLRDLDVFLSVVDMN
EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF
VIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDI
ENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB01374 Gly m conglycinin 639 4284 982.7 0
O22120 Gly m 5.0101 543 2033 469.6 2.4e-133
CAA35691 Gly m conglycinin 605 2033 469.6 2.8e-133
Q9FZP9 Gly m 5.0201 559 1829 423.1 2.5e-119
AAB23463 Gly m conglycinin 439 1583 367.1 1.4e-102
Q198W3 Vig r 2.0101 453 1447 336.1 3.2e-93
B1NPN8 Vig r 2.0201 454 1429 332.0 5.5e-92
AAA33947 Gly m conglycinin 218 1247 290.8 6.5e-80
ACB05815 Lup an 1.0101 611 1211 282.2 7.1e-77
P43238 Ara h 1 626 1147 267.6 1.8e-72
P43237 Ara h 1 614 1146 267.4 2.1e-72
CAD87731 Len c 1.0102 415 880 206.8 2.3e-54
CAF25232 Pis s 1.0101 415 872 205.0 8.3e-54
CAF25233 Pis s 1.0102 415 865 203.4 2.5e-53
CAD87730 Len c 1.0101 418 850 200.0 2.7e-52
P09799 Gos h 2 605 569 135.9 7.9e-33
P09801 Gos h 1 588 547 130.9 2.5e-31
Q9SPL3 Mac i 1.0101 625 544 130.2 4.3e-31
Q9SPL4 Mac i 1.0201 666 539 129.0 1e-30
B3STU4 Car i 2.0101 792 506 121.5 2.3e-28
AAF18269 Jug r 2 593 497 119.5 6.8e-28
AAM54366 Jug n 2 481 436 105.6 8.1e-24
AAK15089 Ses i 3 585 437 105.8 8.7e-24
EF116865 Pis v 3.0101 519 385 94.0 2.8e-20
AAL86739 Cor a 11 448 380 92.9 5.2e-20
A0A2I4E5L6 Jug r 6.0101 502 372 91.0 2.1e-19
AAM73729 Ana o 1.0102 536 345 84.8 1.6e-17
AAM73730 Ana o 1.0101 538 345 84.8 1.6e-17
V9VGU0 Pin k 2.0101 463 286 71.4 1.5e-13
BAB21619 Gly m Bd28K 473 222 56.8 3.9e-09
DQ631677 Pis v 2.0201 472 195 50.7 2.7e-07
A0A0S3B0K0 Coc n 1.0101 490 190 49.5 6.3e-07
P09802 Gos h 3 509 172 45.4 1.1e-05
DQ631676 Pis v 2.0101 496 165 43.8 3.3e-05
Q9SB11 Gly m 6.0401 563 164 43.6 4.5e-05
CAA68460 Gly m glycinin G2 485 156 41.8 0.00013
P04405 Gly m 6.0201 485 156 41.8 0.00013
CAA26383 Tri a gliadin 296 151 40.8 0.00016
AAA33966 Gly m glycinin G1 495 155 41.5 0.00016
P04776 Gly m 6.0101 495 155 41.5 0.00016
AAA34290 Tri a gliadin 296 150 40.6 0.00019
AAO38859 Ber e 2 465 134 36.8 0.0041
ADN39440 Pru du 6.0101 551 135 37.0 0.0043
3EHK_A Pru du 6 531 134 36.7 0.0048
AAA34279 Tri a gliadin 313 129 35.8 0.0056
AAA34278 Tri a gliadin 319 127 35.3 0.0079
O82580 Ara h 3 507 130 35.8 0.0086
AAC63045 Ara h 3 510 130 35.8 0.0087
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 982.7 bits 4284,  Expect = 0
 Identities = 639/639 100%, Positives = 639/639 100%, Gaps = 0/639 0%
Query  1    MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL 60
            MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL
Sbjct  1    MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL 60
Query  61   LKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK 120
            LKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK
Sbjct  61   LKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK 120
Query  121  EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED 180
            EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED
Sbjct  121  EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED 180
Query  181  QDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS 240
            QDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS
Sbjct  181  QDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS 240
Query  241  QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA 300
            QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA
Sbjct  241  QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA 300
Query  301  LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLS 360
            LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLS
Sbjct  301  LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLS 360
Query  361  STQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIR 420
            STQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIR
Sbjct  361  STQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIR 420
Query  421  ELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRNPQLRDLDVFLSVVDMN 480
            ELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRNPQLRDLDVFLSVVDMN
Sbjct  421  ELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRNPQLRDLDVFLSVVDMN 480
Query  481  EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF 540
            EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF
Sbjct  481  EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF 540
Query  541  VIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDI 600
            VIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDI
Sbjct  541  VIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDI 600
Query  601  ENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639
            ENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY
Sbjct  601  ENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639

Sequence Alignment: 2. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 469.6 bits 2033,  Expect = 2e-133
 Identities = 460/532 86%, Positives = 500/532 93%, Gaps = 53/532 9%
Query  65   EEEECEEGQIPRPRP--QHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 122
            E+EECEEG+IPRPRP  QHPERE QQ GEKEEDE EQPRP PFPRP QP QEEEHEQ+EE
Sbjct  2    EKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRP-QPRQEEEHEQREE 60
Query  123  HEWHRKEEKHGGKGSEEE-------QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESE 175
            +EW RKEEK G KGSEEE       QDER+ P P  PHQKEE K+E              
Sbjct  61   QEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERKQE-------------- 106
Query  176  EEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQR 235
                 +DEDEEQ +ES+ESE SE     RRHKNKNPF F S RF+TLFKNQYG +RVLQR
Sbjct  107  -----EDEDEEQQRESEESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIRVLQR 157
Query  236  FNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNL 295
            FN+RS QLQNLRDYRILEFNSKPNTLLLP+HADADYLIVILNGTAIL+LVNNDDRDSY L
Sbjct  158  FNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRL 217
Query  296  QSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFE 355
            QSGDALRVP+GTT+YVVNPDN+ENLR+I                   TLAIPVNKPGRFE
Sbjct  218  QSGDALRVPSGTTYYVVNPDNNENLRLI-------------------TLAIPVNKPGRFE 258
Query  356  SFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEIS 415
            SFFLSST+AQQSYLQGFS+NILEASYDTKFEEINKVLF REEGQQQGE+RLQESVIVEIS
Sbjct  259  SFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEIS 318
Query  416  KKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFL 474
            K+QIR LSK AKSSSRKTISSEDKPFNL SRDPIYSNKLGK+FEIT ++NPQLRDLD+FL
Sbjct  319  KEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFL 378
Query  475  SVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAEL 534
            S+VDMNEGAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAEL
Sbjct  379  SIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL 438
Query  535  SEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFP 594
            SEQDIFVIPAGYPV+VNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFP
Sbjct  439  SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFP 498
Query  595  RSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639
             SA+ +E L+K+Q ESYFVDAQP++KEEGNKGRKGPLSSILRAFY
Sbjct  499  GSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 543

Sequence Alignment: 3. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 469.6 bits 2033,  Expect = 3e-133
 Identities = 517/595 86%, Positives = 561/595 94%, Gaps = 54/595 9%
Query  1    MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL 60
            MMRARFPLLLLG+VFLASVSVSFGIAYWEK+NP HNKCL+SCNSE+DSYRNQACHARCNL
Sbjct  1    MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYRNQACHARCNL 60
Query  61   LKVEEEEECEEGQIPRPRP--QHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHE 118
            LKVE+EE CEEG+IPRPRP  QHPERE QQ GEKEEDE EQPRP PFPRP QP QEEEHE
Sbjct  61   LKVEKEE-CEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRP-QPRQEEEHE 118
Query  119  QKEEHEWHRKEEKHGGKGSEEE-------QDEREHPRPHQPHQKEEEKHEWQHKQEKHQG 171
            Q+EE+EW RKEEK G KGSEEE       QDER+ P P  PHQKEE              
Sbjct  119  QREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERN------------ 166
Query  172  KESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVR 231
                   E++DEDEEQ +ES+ESE SE     RRHKNKNPF F S RF+TLFKNQYG +R
Sbjct  167  -------EEEDEDEEQQRESEESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIR 215
Query  232  VLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRD 291
            VLQRFN+RS QLQNLRDYRILEFNSKPNTLLLP+HADADYLIVILNGTAIL+LVNNDDRD
Sbjct  216  VLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRD 275
Query  292  SYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKP 351
            SY LQSGDALRVP+GTT+YVVNPDN+ENL                   R+ITLAIPVNKP
Sbjct  276  SYRLQSGDALRVPSGTTYYVVNPDNNENL-------------------RLITLAIPVNKP 316
Query  352  GRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVI 411
            GRFESFFLSST+AQQSYLQGFS+NILEASYDTKFEEINKVLF REEGQQQGE+RLQESVI
Sbjct  317  GRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVI 376
Query  412  VEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDL 470
            VEISK+QIR LSK AKSSSRKTISSEDKPFNL SRDPIYSNKLGK+FEIT ++NPQLRDL
Sbjct  377  VEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDL 436
Query  471  DVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKY 530
            D+FLS+VDMNEGAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKY
Sbjct  437  DIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKY 496
Query  531  RAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQE 590
            RAELSEQDIFVIPAGYPV+VNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQE
Sbjct  497  RAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQE 556
Query  591  LAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639
            LAFP SA+ +E L+K+Q ESYFVDAQP++KEEGNKGRKGPLSSILRAFY
Sbjct  557  LAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 605

Sequence Alignment: 4. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 423.1 bits 1829,  Expect = 3e-119
 Identities = 552/558 98%, Positives = 556/558 99%, Gaps = 20/558 3%
Query  63   VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 122
            VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE
Sbjct  1    VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEE 60
Query  123  HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD 182
            HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD
Sbjct  61   HEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQD 120
Query  183  EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ 242
            EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ
Sbjct  121  EDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ 180
Query  243  LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR 302
            LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR
Sbjct  181  LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALR 240
Query  303  VPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSST 362
            VPAGTT+YVVNPDNDENLRMI                   TLAIPVNKPGRFESFFLSST
Sbjct  241  VPAGTTYYVVNPDNDENLRMI-------------------TLAIPVNKPGRFESFFLSST 281
Query  363  QAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIREL 422
            QAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIREL
Sbjct  282  QAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIREL 341
Query  423  SKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNE 481
            SKHAKSSSRKTISSEDKPFNL SRDPIYSNKLGKLFEIT ++NPQLRDLDVFLSVVDMNE
Sbjct  342  SKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNE 401
Query  482  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 541
            GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV
Sbjct  402  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 461
Query  542  IPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIE 601
            IPAGYPV+VNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFP SAKDIE
Sbjct  462  IPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIE 521
Query  602  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639
            NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY
Sbjct  522  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 559

Sequence Alignment: 5. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 367.1 bits 1583,  Expect = 1e-102
 Identities = 310/411 75%, Positives = 369/411 89%, Gaps = 26/411 6%
Query  205  RHKNKNPFHF-NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 263
            R    NPF+F +S  FQTLF+NQ   +R+LQRFNKRS QL+NLRDYRI++F SKPNT+LL
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  264  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMI 323
            PHHADAD+L+ +L+G AILTLVNNDDRDSYNL+ GDA R+PAGTT+Y+VNP + +NL   
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNL--- 143
Query  324  AGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDT 383
                            ++I LAIPVNKPGR++ FFLSSTQAQQSYLQGFS NILE S+ +
Sbjct  144  ----------------KIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHS 187
Query  384  KFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNL 443
            +FEEIN+VLFG EE     E+R QE VIVE+SK+QIR+LS+ AKSSSRKTISSED+PFNL
Sbjct  188  EFEEINRVLFGEEE-----EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNL 242
Query  444  GSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEG 502
             SR+PIYSN +GK+FEIT ++NPQLRDLD+FLS VD+NEGAL+LPHFNSKAIV+LVINEG
Sbjct  243  RSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEG 302
Query  503  EANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFG 562
            +ANIELVGIKEQQQ+Q+QEE+PLEV++YRAELSE D+FVIPA YP +VNATS+LNF+AFG
Sbjct  303  DANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFG 362
Query  563  INAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEE 622
            INAENNQRNFLAG KDNV+ QI  QVQELAFP SA+D+E L+K Q ESYFVDAQPQQKEE
Sbjct  363  INAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEE 422
Query  623  GNKGRKGPLSSILRAFY 639
            G+KGRKGP+ SIL A+Y
Sbjct  423  GSKGRKGPFPSILGALY 439

Sequence Alignment: 6. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 336.1 bits 1447,  Expect = 3e-93
 Identities = 293/422 69%, Positives = 367/422 86%, Gaps = 27/422 6%
Query  195  EGSESQREPRRHKNKNPFHFNS-KRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILE 253
            E  ESQ E       NPF+FNS +RF+TLFKNQYGH+RV++RF++RS+Q+QNL +YR++E
Sbjct  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
Query  254  FNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVN 313
            F SKPNTLLLPHHADAD+L+V+LNG AILTLVN D RDSY L+ G A ++PAGTTF++VN
Sbjct  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
Query  314  PDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFS 373
            P+                  DND NLR+I LAIPVN P RF++FFLSST+AQQSYL+GFS
Sbjct  148  PN------------------DND-NLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFS 188
Query  374  KNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKT 433
            KNILEAS+D+ F+EI++VLFG E  QQ+GEE  +E VIVE+ ++QIREL KHAKSSSRK 
Sbjct  189  KNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKE 248
Query  434  ISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSK 492
            +SS+D+PFNL + +PIYSNK+G+ +EIT ++NPQL+DLDVF+S VDM EG L+LPH+NSK
Sbjct  249  LSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSK 308
Query  493  AIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNA 552
            AIV+LVINEGEA IELVG  +QQQ    +++ LEV++YRAELSE D+FVIPA YPV +NA
Sbjct  309  AIVILVINEGEAKIELVGPSDQQQ----QDESLEVQRYRAELSEDDVFVIPAAYPVAINA 364
Query  553  TSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYF 612
            TS+LNFFAFGINAENNQRNFLAG KDNV+S+IP++V +++FP S   +E LIK QSES+F
Sbjct  365  TSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHF 424
Query  613  VDAQP--QQKEEGNKGRKGPLSSILRAFY 639
            VDAQP  QQ+EEG+KGRKG LSSIL ++Y
Sbjct  425  VDAQPEQQQREEGHKGRKGSLSSILGSLY 453

Sequence Alignment: 7. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 332.0 bits 1429,  Expect = 6e-92
 Identities = 284/406 69%, Positives = 360/406 88%, Gaps = 27/406 6%
Query  205  RHKNKNPFHFNSKR-FQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 263
            R KN NPF+FNS R F+TLF+NQ+GH+RVLQRF++RS+Q+QNL +YR++E+ SKPNTLLL
Sbjct  41   RGKN-NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLL 99
Query  264  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMI 323
            PHHADAD+L+V+LNG A+LTLVN D RDS  L+ G A ++PAGTTF++VNPD        
Sbjct  100  PHHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPD-------- 151
Query  324  AGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDT 383
                      DN ENLR+I LA+PVN P RF+ FFLSST+AQQSYLQGFSKNILEAS+D+
Sbjct  152  ----------DN-ENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDS 200
Query  384  KFEEINKVLFGREEGQQQ--GEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF 441
              +EI++VLFG EEGQQQ  G+E  QE VIVE+ ++QIREL+KHAKSSS+K++SSED+PF
Sbjct  201  DIKEISRVLFG-EEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPF 259
Query  442  NLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVIN 500
            NL ++ PIYSNKLG+ FEIT ++NPQLRDLD+F+  VDM EG+L+LPH+NSKAIV+LVIN
Sbjct  260  NLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVIN 319
Query  501  EGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFA 560
            EG+ANIELVG +EQQ++Q+++E+  EV++YRAELSE D+F+IPA YPV +NATS+LNFFA
Sbjct  320  EGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFA 379
Query  561  FGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQ- 619
            FGINAENNQRNFLAG KDNVIS+IP++V ++ FP S + ++ LIK QSES FVDAQP+Q 
Sbjct  380  FGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQ 439
Query  620  -KEEGNKGRKGPL 631
             +EE  KG KGP+
Sbjct  440  EREEARKGGKGPF 452

Sequence Alignment: 8. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 290.8 bits 1247,  Expect = 7e-80
 Identities = 191/217 88%, Positives = 208/217 95%, Gaps = 1/217 0%
Query  423  SKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNE 481
            SK AKSSSRKTISSEDKPFNLGSRDPIYS KLGK+FEIT ++NPQLRDLD+FLS+VDMNE
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  482  GALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFV 541
            GAL+LPHFNSKAIV+LVINEG+ANIELVG+KEQQQ QQQEEQPLEVRKYRAELSEQDIFV
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
Query  542  IPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIE 601
            IPAGYPV+VNATS+LNFFA GINAENNQRNFLAGS+DNVISQIPSQVQELAFP SA+ +E
Sbjct  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
Query  602  NLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 639
             L+K+Q ESYFVDAQP +KEEGNKGRKGPLSSILRAFY
Sbjct  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218

Sequence Alignment: 9. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 282.2 bits 1211,  Expect = 7e-77
 Identities = 310/585 52%, Positives = 453/585 77%, Gaps = 76/585 12%
Query  2    MRARFPLL--LLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCN 59
            MR R+P+L  LLGVVFL + S+  GIAY                 EKD  +N        
Sbjct  4    MRVRLPMLILLLGVVFLLAASI--GIAY----------------GEKDFTKNPP------ 39
Query  60   LLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQ 119
              K  EEEE E  Q PRPR Q+ E+ER+ H  +E+ +GE  R        +  QEEEHE+
Sbjct  40   --KEREEEEHEPRQQPRPR-QQEEQERE-HRREEKHDGEPSRG---RSQSEESQEEEHER 92
Query  120  KEEHEWHRKEEKHG--GKGSEEEQDERE-HPRPHQPHQKEEEKHEWQHKQEKHQGKE-SE 175
            + EH   R++E++    +  EEE++E E +PR ++P+ + EE+ E +++Q    G +   
Sbjct  93   RREHHREREQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSSSGSQRGG 152
Query  176  EEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQR 235
             +E  Q  +    +E +E E  +S+ + RR++  NP+HF+S RFQT ++N+ G++RVL+R
Sbjct  153  GDERRQHRERRVHREEREQE-QDSRSDSRRQR--NPYHFSSNRFQTYYRNRNGQIRVLER 209
Query  236  FNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNL 295
            FN+R+ +L+NL++YRI+EF SKPNTL+LP H+DAD+++V+LNG A +T+VN D R  YNL
Sbjct  210  FNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNL 269
Query  296  QSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFE 355
            + GDALR+PAGTT Y++NPD                  DN +NLR+  LAIP+N PG++ 
Sbjct  270  EQGDALRLPAGTTSYILNPD------------------DN-QNLRVAKLAIPINNPGKLY 310
Query  356  SFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREE-----GQQQGEERLQ--E 408
             F+ S+T+ QQSY+ GFSKN LEA+++T++EEI +VL+G +E      Q++G+E+ +  E
Sbjct  311  DFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRRGQEQSHQDE 370
Query  409  SVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQR-NPQL 467
             VIV +SKKQI+EL KHA+SSS +   SE  PFNL S  PIYSNK+G ++EIT   NPQ+
Sbjct  371  GVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQF 430
Query  468  RDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLE- 526
            +DL++ L+  ++NEGAL+LPH+NSKAI ++V++EGE N ELVGI++QQ++Q ++E+  E 
Sbjct  431  QDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQ 490
Query  527  ----VRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVIS 582
                VR+Y  +LS+ D+F+IPAG+P+ +NA+S+L ++ FGINA  NQRNFLAGS+DNVI 
Sbjct  491  GEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRLLGFGINANENQRNFLAGSEDNVIK 550
Query  583  QIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKE----EGNKGRKGPLSSILRAF 638
            Q+  +V+EL FP S +D+E LIK+Q +SYF +AQPQQ++    EG +GR+GP+SSIL A+
Sbjct  551  QLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEGRRGRRGPISSILNAL 610
Query  639  Y 639
            Y
Sbjct  611  Y 611

Sequence Alignment: 10. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 267.6 bits 1147,  Expect = 2e-72
 Identities = 287/576 49%, Positives = 408/576 70%, Gaps = 110/576 19%
Query  2    MRARF-PL-LLLGVVFLASVSVSFGIA--YWEK-QNPSHNKCLRSCNSEKDSYRNQACHA 56
            MR R  PL LLLG++ LASVS +   +  Y +K +NP   +CL+SC  E D  + +AC +
Sbjct  1    MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEPDDLKQKACES 60
Query  57   RCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEE 116
            RC   K+E +  C    +  PR  H     Q+    E   G QP  +   R RQP +EE 
Sbjct  61   RCT--KLEYDPRC----VYDPRG-HTGTTNQRSPPGERTRGRQPGDYDDDR-RQPRREEG 112
Query  117  HEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEE 176
                    W       G +  E E+D R      QP +        Q ++ + +G+E E+
Sbjct  113  GR------WG----PAGPREREREEDWR------QPREDWRRPSHQQPRKIRPEGREGEQ 156
Query  177  EEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRF 236
            E                + GS  + E  R+   NPF+F S+RF T + NQ G +RVLQRF
Sbjct  157  E--------------WGTPGSHVREETSRN---NPFYFPSRRFSTRYGNQNGRIRVLQRF 199
Query  237  NKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQ 296
            ++RS+Q+QNL+++RI++  +KPNTL+LP HADAD ++VI  G A +T+ N ++R S+NL 
Sbjct  200  DQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLD 259
Query  297  SGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFES 356
             G ALR+P+G   Y++N                    DN +NLR+  +++PVN PG+FE 
Sbjct  260  EGHALRIPSGFISYILN------------------RHDN-QNLRVAKISMPVNTPGQFED 300
Query  357  FFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ--------- 407
            FF +S++ Q SYLQGFS+N LEA+++ +F EI +VL+    G +Q EER Q         
Sbjct  301  FFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQ-EERGQRRWSTRSSE 359
Query  408  --ESVIVEISKKQIRELSKHAKSSSRKTISSED---KPFNLGSRDPIYSNKLGKLFEIT- 461
              E VIV++SK+++ EL+KHAKS S+K    E     P NL   +P  SN +GKLFE+  
Sbjct  360  NNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNFGKLFEVKP 419
Query  462  -QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI-KEQQQRQQ 519
             ++NPQL+DLD+ L+ V++ EGAL LPHFNSKA+V++V+N+G  N+ELV + KEQQQR +
Sbjct  420  DKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGR 479
Query  520  QEEQP----------LEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQ 569
            +EE+            EVR+Y A L E D+F++PA +PV +NA+S+L+++ FGINAENN+
Sbjct  480  REEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNH 539
Query  570  RNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQK--------- 620
            R FLAG KDNVI QI  Q ++LAFP S + +E LIK+Q ES+FV A+PQ +         
Sbjct  540  RIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSPEK 599
Query  621  --------EEGNKGRKGPLSSILRAF 638
                    EE N+G KGPL SIL+AF
Sbjct  600  ESPEKEDQEEENQGGKGPLLSILKAF 625

Sequence Alignment: 11. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 267.4 bits 1146,  Expect = 2e-72
 Identities = 287/569 50%, Positives = 411/569 72%, Gaps = 112/569 19%
Query  2    MRARF-PL-LLLGVVFLASVSVSFGIAYWEK-QNPSHNKCLRSCNSEKDSYRNQACHARC 58
            MR R  PL LLLG++ LASVS +   + + K +NP   +CL+SC  E D  + +AC +RC
Sbjct  1    MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDDLKQKACESRC 60
Query  59   NLLKVEEEEEC--EEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEE 116
               K+E +  C  + G   +   +HP  ER +        G QP  +   R RQP +EE 
Sbjct  61   T--KLEYDPRCVYDTGATNQ---RHPPGERTR--------GRQPGDYDDDR-RQPRREE- 105
Query  117  HEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRP-HQPHQKEEEKHEWQHKQEKHQGKESE 175
                            GG+    E  ERE      QP +        Q ++ + +G+E E
Sbjct  106  ----------------GGRWGPAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGE 149
Query  176  EEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQR 235
            +E                + GSE + E  R+   NPF+F S+RF T + NQ G +RVLQR
Sbjct  150  QE--------------WGTPGSEVREETSRN---NPFYFPSRRFSTRYGNQNGRIRVLQR 192
Query  236  FNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNL 295
            F++RS+Q+QNL+++RI++  ++PNTL+LP HADAD ++VI  G A +T+ N ++R S+NL
Sbjct  193  FDQRSKQFQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNL 252
Query  296  QSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFE 355
              G ALR+P+G   Y++N                    DN +NLR+  +++PVN PG+FE
Sbjct  253  DEGHALRIPSGFISYILN------------------RHDN-QNLRVAKISMPVNTPGQFE 293
Query  356  SFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ-------- 407
             FF +S++ Q SYLQGFS+N LEA+++ +F EI +VL+    G +Q EER Q        
Sbjct  294  DFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQ-EERGQRRRSTRSS 352
Query  408  --ESVIVEISKKQIRELSKHAKSSSRKTISSED--KPFNLGSRDPIYSNKLGKLFEIT-- 461
              E VIV++SK++++EL+KHAKS S+K    ED   P NL   +P  SN +G+LFE+   
Sbjct  353  DNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGRLFEVKPD 412
Query  462  QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI-KEQQQR--- 517
            ++NPQL+DLD+ L+ V++ EGAL LPHFNSKA+V++V+N+G  N+ELV + KEQQQR   
Sbjct  413  KKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRR 472
Query  518  -QQQEEQPL---------EVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAEN 567
             Q+ EE+           EVR+Y A L E D+F++PA +PV +NA+S+L+++ FGINAEN
Sbjct  473  EQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAEN 532
Query  568  NQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQK------- 620
            N+R FLAG KDNVI QI  Q ++LAFP S + +E LIK+Q ES+FV A+PQ +       
Sbjct  533  NHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEK 592
Query  621  ---EEGNKGRKGPLSSILRAF 638
               EE N+G KGPL SIL+AF
Sbjct  593  EDQEEENQGGKGPLLSILKAF 613

Sequence Alignment: 12. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 206.8 bits 880,  Expect = 2e-54
 Identities = 223/398 56%, Positives = 337/398 84%, Gaps = 35/398 8%
Query  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
            R   +NPF F S RFQT+++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
            ++ DAD+++V+L+G A+LT++N++DR+S+NL+ GD +++PAGT               IA
Sbjct  62   QYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGT---------------IA 106
Query  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
                Y+ N D++E+LR++ LAIPVN PG++ESF+LS TQ Q S+L GF+K+ILEA+++T 
Sbjct  107  ----YLANRDDNEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTD 162
Query  385  FEEINKVLFGREEGQQQGEERL--------QESVIVEISKKQIRELSKHAKSSSRKTISS 436
            +EEI KVL+  +E + Q    L        +E+VIV++S++QI+ELSK+AKSSS+K++SS
Sbjct  163  YEEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSS 222
Query  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
            E +PFNL SR+PIYSNK+GK+FEIT ++NPQL+DLD+F++ V++ EG+L+LP++NS+AIV
Sbjct  223  ESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIV 282
Query  496  VLVINEGEANIELVGIKEQQQRQ-------QQEEQPLEVRKYRAELSEQDIFVIPAGYPV 548
            ++ +NEG+   ELVG + + QR+       Q+EE   +V++YRA+LS  D+FV+PAG+PV
Sbjct  283  IVTVNEGKGYFELVGQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPV 342
Query  549  MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQS 608
             +NA+SDLN+  FGINA+NNQRNFLAG +DNVISQI   V+ELAFP S+++++ L+ +Q 
Sbjct  343  AINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQK 402
Query  609  ESYFVDAQPQQKE 621
            +S+F +AQP Q E
Sbjct  403  QSHFANAQPLQIE 415

Sequence Alignment: 13. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 205.0 bits 872,  Expect = 8e-54
 Identities = 226/398 56%, Positives = 333/398 83%, Gaps = 35/398 8%
Query  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
            R   +NPF F S RFQTL++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP+TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLP 61
Query  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
            ++ DAD+++V+L+G A LT++ ++DR+S+NL+ GDA+++PAGT               IA
Sbjct  62   QYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGT---------------IA 106
Query  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
                Y+ N D++E+LR++ LAIPVNKPG+++SF+LS TQ Q S L GFSKNILEA+++T 
Sbjct  107  ----YLANRDDNEDLRVLDLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTN 162
Query  385  FEEINKVLFGREEGQQQGEERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISS 436
            +EEI KVL+ ++E + Q    L+        E+VIV++S++QI ELSK+AKSSS+K++SS
Sbjct  163  YEEIEKVLLEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSS 222
Query  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
            E  PFNL SR+PIYSNK+GK+FEIT ++N QL+DLD+F++ VD+ EG+L+LP++NS+AIV
Sbjct  223  ESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIV 282
Query  496  VLVINEGEANIELVGIKEQQQ-------RQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV 548
            ++ + EG+ + ELVG + + Q        +Q+EE   +V+ YRA+LS  D+FVIPAG+PV
Sbjct  283  IVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPV 342
Query  549  MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQS 608
             +NA+SDLN+  FGINAENN+RNFLAG +DNVISQ+   V+ELAFP S+ +++ L+K+Q 
Sbjct  343  AINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQK 402
Query  609  ESYFVDAQPQQKE 621
            +SYF +AQP Q+E
Sbjct  403  QSYFANAQPLQRE 415

Sequence Alignment: 14. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 203.4 bits 865,  Expect = 2e-53
 Identities = 224/398 56%, Positives = 329/398 82%, Gaps = 35/398 8%
Query  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
            R   +NPF F S RFQTL++N+ GH+R+LQ+F+KRS+ ++NL++YR+LE+ SKP TL+LP
Sbjct  2    RSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLP 61
Query  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
            +  DAD+++V+L+G A LT++ ++DR+S+NL+ GD +++PAGT               IA
Sbjct  62   QCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGT---------------IA 106
Query  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
                Y+ N D++E+LR++ L IPVNKPG+++SF+LS TQ Q S L GFSKNILEA+++T 
Sbjct  107  ----YLANRDDNEDLRVLDLTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTN 162
Query  385  FEEINKVLFGREEGQQQGEERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISS 436
            +EEI KVL+ ++E + Q    L+        E+VIV++S++QI ELSK+AKSSS+K++SS
Sbjct  163  YEEIEKVLLEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSS 222
Query  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
            E  PFNL SR+PIYSNK+GK+FEIT ++N QL+DLD+F++ VD+ EG+L+LP++NS+AIV
Sbjct  223  ESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIV 282
Query  496  VLVINEGEANIELVGIKEQQQ-------RQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV 548
            ++ + EG+ + ELVG + + Q        +Q+EE   +V+ YRA+LS  D+FVIPAG+PV
Sbjct  283  IVTVTEGKGDFELVGQRNENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPV 342
Query  549  MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQS 608
             +NA+SDLN+  FGINAENN+RNFLAG +DNVISQ+   V+ELAFP S+ +++ L+K+Q 
Sbjct  343  AINASSDLNLIGFGINAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQK 402
Query  609  ESYFVDAQPQQKE 621
            +SYF +AQP Q+E
Sbjct  403  QSYFANAQPLQRE 415

Sequence Alignment: 15. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 200.0 bits 850,  Expect = 3e-52
 Identities = 227/398 57%, Positives = 336/398 84%, Gaps = 38/398 9%
Query  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
            R   +NPF F S RFQT+++N+ GH+R+LQRF+KRS+ ++NL++YR+LE+ SKP+T++LP
Sbjct  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
Query  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
            +  DAD+++V+L+G AILT++N++DR+S+NL+ GD +++PAGT               IA
Sbjct  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGT---------------IA 106
Query  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
                Y+ N D++E+LR++ LAIPVN+PG+++SF+LS TQ Q S+L GFSKNILEA+++T+
Sbjct  107  ----YLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTE 162
Query  385  FEEINKVLFGREEGQQQGEERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISS 436
            +EEI KVL+  +E + Q    L+        E VIV++S++QI ELSK+AKSSS+K++SS
Sbjct  163  YEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSS 222
Query  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
            E +PFNL SR+PIYSNK+GK+FEIT ++NPQL+DLD+F++ V++ EG+L+LP++NS+AIV
Sbjct  223  ESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIV 282
Query  496  VLVINEGEANIELVGIK-EQQQRQ---------QQEEQPLEVRKYRAELSEQDIFVIPAG 545
            ++ +NEG+ + ELVG + E QQ Q         Q+EE   +V++YRA LS  D++VIPAG
Sbjct  283  IVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAG 342
Query  546  YPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIK 605
            +PV +NA+SDLN+  FGINA+NNQRNFLAG +DNVISQI   V+ELAFP S+++++ L+ 
Sbjct  343  HPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLT 402
Query  606  SQSESYFVDAQPQQKE 621
            +Q +S+F +AQP Q E
Sbjct  403  NQKQSHFANAQPLQIE 418

Sequence Alignment: 16. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 135.9 bits 569,  Expect = 8e-33
 Identities = 208/565 36%, Positives = 368/565 65%, Gaps = 84/565 14%
Query  13   VVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKV--EEEEECE 70
            VV+L S+ +SFG+    K  P      RS +  +  Y +  C  RC L      E+++CE
Sbjct  9    VVLLFSLFLSFGLLCSAKDFPGR----RSEDDPQQRYED--CRKRCQLETRGQTEQDKCE 62
Query  71   EGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEE 130
            +            R   Q  E+++ +GE P+       R+ +   +H Q+EE    R+  
Sbjct  63   D------------RSETQLKEEQQRDGEDPQ-------RRYQDCRQHCQQEE----RRLR 99
Query  131  KHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQ-EKHQG--KESEEE-EEDQDEDEE 186
             H  +   E+ +++++ +P +  ++ +++ +WQ ++ E+ Q   KE  E+ +ED  + E 
Sbjct  100  PHCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGER 159
Query  187  QDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNL 246
            ++K  +E E  E   E  +++  NP++F+ + FQ  F+ ++G+ RVLQRF  + + L+ +
Sbjct  160  ENKWREEEE--EESDEGEQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGI 217
Query  247  RDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAG 306
             ++RI  + + PNT++LPHH DA+ + V+ NG   +T+V +++++SYN+  G  +R+PAG
Sbjct  218  NEFRIAILEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAG 277
Query  307  TTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQ 366
            +T Y+ N DN E L +                     L  PVN PG+F+ FF +  +  Q
Sbjct  278  STVYLANQDNREKLTIA-------------------VLHRPVNNPGQFQKFFPAGQENPQ 318
Query  367  SYLQGFSKNILEASYDTKFEEINKVLFGREEGQ-QQGEERLQESVIVEISKKQIRELSKH 425
            SYL+ FS+ ILEA ++T+ E+++++  GR+  + QQG+  ++++     S++QIR LS+ 
Sbjct  319  SYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKA-----SQEQIRALSQG 373
Query  426  AKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRN--PQLRDLDVFLSVVDMNEGA 483
            A S   K   SE   FNL S+ P YSN+ G+++E   RN   QLR++D  +   ++N+G+
Sbjct  374  ATSPRGK--GSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGS 431
Query  484  LFLPHFNSKAIVVLVINEGEANIELV--GIKEQ------QQRQQQEEQPLEVR-----KY 530
            +F+PH+NSKA  V+++ EG  ++E+V   +  Q      ++ ++QEEQ +E R     + 
Sbjct  432  IFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRV 491
Query  531  RAELSEQDIFVIPAGYPVMVNATS--DLNFFAFGI-NAENNQRNFLAGSKDNVISQIPSQ 587
            RA+LS  ++FV+PAG+PV   A+   DL ++ FG+ N ++N+R F+AG K N + Q   Q
Sbjct  492  RAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAG-KTNNVRQWDRQ 550
Query  588  VQELAFPRSAKDIENLIKSQ-SESYFVDAQPQQKEEGNKGRKGPLSSIL 635
             +ELAF   ++ ++ +  +   ESYFV  + ++  +  +G   PLS  L
Sbjct  551  AKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGSNNPLSPFL 599

Sequence Alignment: 17. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 130.9 bits 547,  Expect = 2e-31
 Identities = 212/558 37%, Positives = 350/558 62%, Gaps = 74/558 13%
Query  13   VVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEECEEG 72
            VV+L S+ +SFG+    K  P           +    R + C  RC        E    G
Sbjct  9    VVLLFSLFLSFGLLCSAKDFPGRR------GDDDPPKRYEDCRRRC--------EWDTRG 54
Query  73   QIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKH 132
            Q  + + Q  E  + Q+GEK++ +  +P     P+ R    ++E  Q+EE +  + +++ 
Sbjct  55   Q--KEQQQCEESCKSQYGEKDQQQRHRPED---PQRRYEECQQECRQQEERQRPQCQQRC 109
Query  133  GGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQ 192
              +  +E+Q  + + +  Q H  ++E+   + +Q   + +E  +E   + E EE+ +E +
Sbjct  110  LKRFEQEQQQSQRQFQECQQHCHQQEQRPERKQQCVRECRERYQENPWRREREEEAEEEE 169
Query  193  ESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRIL 252
              EG + Q       + NPFHF+ + FQ+ F+ ++G+ RVLQRF  R   L+ + ++R+ 
Sbjct  170  TEEGEQEQ-------SHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLS 222
Query  253  EFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVV 312
             + + PNT++LPHH DA+ + ++ NG   LT++ +++++SYN+  G  +RVPAG+T Y+ 
Sbjct  223  ILEANPNTFVLPHHCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLA 282
Query  313  NPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGF 372
            N DN E L +IA                   L  PVN P +FE FF + +Q  QSYL+ F
Sbjct  283  NQDNKEKL-IIA------------------VLHRPVNNPRQFEEFFPAGSQRPQSYLRAF 323
Query  373  SKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRK 432
            S+ ILE +++T+ E++++ LFG   G+Q    +  + +  + S++QIR LS+ A S   K
Sbjct  324  SREILEPAFNTRSEQLDE-LFG---GRQSHRRQQGQGMFRKASQEQIRALSQEATSPREK 379
Query  433  TISSEDKPFNLGSRDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNS 491
              S E   FNL  R P YSN+ G+++E   R   QL D++V +S + +N+G++F+PH+NS
Sbjct  380  --SGERFAFNLLYRTPRYSNQNGRFYEACPREFRQLSDINVTVSALQLNQGSIFVPHYNS 437
Query  492  KAIVVLVINEGEANIELVGI-----------KEQQQRQQQEEQ--PLEVRKYRAELSEQD 538
            KA  V+++NEG   +E+V             +EQQQ Q+QEE+    + RK R++LS  D
Sbjct  438  KATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQEQEQEEERRSGQYRKIRSQLSRGD 497
Query  539  IFVIPAGYPVMVNATSDLNF--FAFG-----INAENNQRNFLAGSKDNVISQIPSQVQEL 591
            IFV+PA +PV   A+ + N+    FG     IN ++NQR F+AG K N + Q  SQ +EL
Sbjct  498  IFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQRIFVAG-KINHVRQWDSQAKEL 556
Query  592  AFPRSAKDIENLIKSQ-SESYFVDAQPQQKEE 622
            AF  S++ ++ +  +   ESYFV  Q Q+  E
Sbjct  557  AFGVSSRLVDEIFNNNPQESYFVSRQRQRASE 588

Sequence Alignment: 18. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 130.2 bits 544,  Expect = 4e-31
 Identities = 212/563 37%, Positives = 357/563 63%, Gaps = 73/563 12%
Query  27   YWEKQNPSHN--KCLRSC-NSEKDSYRNQACHARCNLLKVEEEEECEEGQIPRPR-PQHP 82
            Y  +++P     +C R C   E D  + Q C+ RC   ++ EEEE    +  R R PQ+ 
Sbjct  31   YDNQEDPQTECQQCQRRCRQQESDPRQQQYCQRRCK--EICEEEE----EYNRQRDPQQQ 84
Query  83   ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQD 142
              + Q+  ++ E E   PR     + R    E  +E+++  +  R EE++  +  EE+ +
Sbjct  85   YEQCQKRCQRRETE---PRHMQICQQRC---ERRYEKEKRKQQKRYEEQQ--REDEEKYE 136
Query  143  ER--EHPRPHQPHQKEEE---KH-EWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEG 196
            ER  E      P+Q+E E   +H E Q  + ++Q +   +E++ Q      D  + +  G
Sbjct  137  ERMKEGDNKRDPQQREYEDCRRHCEQQEPRLQYQCQRRCQEQQRQ-HGRGGDLMNPQRGG 195
Query  197  SESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNS 256
            S    E    ++ NP++F+ + + T F+ + GH+ VL+ F  RS+ L+ L++YR++ + +
Sbjct  196  SGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEA 255
Query  257  KPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDN 316
             PN ++LP H DAD +++++ G   L +++ D+R+SYNL+ GD +R+PAGTTFY++N DN
Sbjct  256  NPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDN 315
Query  317  DENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNI 376
            +E L +     F          L+ I+       PG+++ FF +  Q  + YL  FSK I
Sbjct  316  NERLHI---AKF----------LQTIST------PGQYKEFFPAGGQNPEPYLSTFSKEI 356
Query  377  LEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS- 435
            LEA+ +T+ E +  VL     GQQ+      E VI+  S++QIREL++    S R  I  
Sbjct  357  LEAALNTQTERLRGVL-----GQQR------EGVIIRASQEQIRELTRDDSESRRWHIRR 405
Query  436  ---SEDKPFNLGSRDPIYSNKLGKLFEITQRNP-QLRDLDVFLSVVDMNEGALFLPHFNS 491
               S   P+NL ++ P+YSNK G+ +E+   +  QL+D+DV + + ++ +G++  P FN+
Sbjct  406  GGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNT 465
Query  492  KAIVVLVINEGEANIELV--------GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIP 543
            ++  V+V+  GEA++E+         G +   +R+++EE+ +   + RA LS+++  V+ 
Sbjct  466  RSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEEEEE-VHYEQVRARLSKREAIVVL 524
Query  544  AGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIE 601
            AG+PV+  ++ + N+  FAFGINA+NN+ NFLAG + NV+ QI  Q  ELAF  S K++E
Sbjct  525  AGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVE 584
Query  602  NLIKSQSESYFVDA--QPQQKEEGNKGRKGPLSSIL 635
             L  SQ ES F     Q QQ+   +  ++ PL SIL
Sbjct  585  ELFNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSIL 620

Sequence Alignment: 19. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 129.0 bits 539,  Expect = 1e-30
 Identities = 205/564 36%, Positives = 353/564 62%, Gaps = 71/564 12%
Query  27   YWEKQNPSHN--KCLRSCNSEKDSYRNQA-CHARCNLLKVEEEEECEEGQIPRPRPQHPE 83
            Y  + +P  +  +C R C  ++   R Q  C+ RC  +  EEEEE         R + P+
Sbjct  72   YDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEI-CEEEEEYN-------RQRDPQ 123
Query  84   RERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDE 143
            ++ +Q  E+ +    +PR     +  Q   E  +E+++  +  R EE++  +  EE+ +E
Sbjct  124  QQYEQCQERCQRHETEPRHM---QTCQQRCERRYEKEKRKQQKRYEEQQ--REDEEKYEE 178
Query  144  R--EHPRPHQPHQKEEE----KHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGS 197
            R  E      P+Q+E E    + E Q  ++++Q +    E++ Q      D  + +  GS
Sbjct  179  RMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQ-HGRGGDLINPQRGGS 237
Query  198  ESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSK 257
                E    ++ NP++F+ + + T F+ + GH+ VL+ F  RS+ L+ L++YR++ + + 
Sbjct  238  GRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEAN 297
Query  258  PNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDND 317
            PN ++LP H DAD ++++  G   L +++ D+R+SYNL+ GD +R+PAGTTFY++N DN+
Sbjct  298  PNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNN 357
Query  318  ENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNIL 377
            E L +     F          L+ I+       PG+++ FF +  Q  + YL  FSK IL
Sbjct  358  ERLHI---AKF----------LQTIST------PGQYKEFFPAGGQNPEPYLSTFSKEIL 398
Query  378  EASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS-- 435
            EA+ +T+ E +  VL     GQQ+      E VI+  S++QIREL++    S R  I   
Sbjct  399  EAALNTQAERLRGVL-----GQQR------EGVIISASQEQIRELTRDDSESRRWHIRRG 447
Query  436  --SEDKPFNLGSRDPIYSNKLGKLFEITQRNP-QLRDLDVFLSVVDMNEGALFLPHFNSK 492
              S   P+NL ++ P+YSNK G+ +E+   +  QL+D+DV + + ++ +G++  P FN++
Sbjct  448  GESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTR 507
Query  493  AIVVLVINEGEANIELV--------GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPA 544
            +  V+V+  GEA++E+         G +   +R+++EE  +   + +A LS+++  V+P 
Sbjct  508  STKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEED-VHYEQVKARLSKREAIVVPV 566
Query  545  GYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIEN 602
            G+PV+  ++ + N+  FAFGINA+NN+ NFLAG + NV+ QI  Q  ELAF    K++E 
Sbjct  567  GHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEE 626
Query  603  LIKSQSESYFVDAQPQQKEEGNKGRKG--PLSSIL 635
            L  SQ ES F     Q++++ ++  K   PL SIL
Sbjct  627  LFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661

Sequence Alignment: 20. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 121.5 bits 506,  Expect = 2e-28
 Identities = 207/553 37%, Positives = 360/553 65%, Gaps = 85/553 15%
Query  29   EKQNP-----SHNKCLRSCNSEKDSYRNQA-CHARCNLLKVEEEEECEEGQIPRPRPQHP 82
            +++NP      + +C   C  +    R Q  C++RC       EE  EE Q    R Q  
Sbjct  203  DEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRC-------EERLEEEQ----RKQE- 250
Query  83   ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQD 142
            ERER++ G  E+D+           PR P Q  E+ Q++     R +E++  +   E+Q 
Sbjct  251  ERERRR-GRDEDDQN----------PRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQR 299
Query  143  EREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDED--EEQDKESQESEGSESQ 200
            ++E    ++   +++ +++++  Q + Q +E   E + Q +   E Q KE Q  E    Q
Sbjct  300  QQEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQRQCQQRCERQYKEQQGREWGPDQ 359
Query  201  REPRR--------HKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRIL 252
              PRR        ++  NP++F+S+ +++  ++  G V+ L+RF +R++ L+ + +YR++
Sbjct  360  ASPRRESRGREEEQQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVV 419
Query  253  EFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVV 312
             + + PNT++LP+H DA+ +IV+  G A LT+V+ + R+S+NL+ GD +RVPAG T YV+
Sbjct  420  ILEANPNTFVLPYHKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVI 479
Query  313  NPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGF 372
                               N D++E L M+ L  PVN PG+F  ++ +  Q+ +SYL+ F
Sbjct  480  -------------------NQDSNERLEMVKLLQPVNNPGQFREYYAAGAQSTESYLRVF 520
Query  373  SKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRK 432
            S +IL A+ +T  + + + +        Q E+R  E VI+  S++++R LS+HA S+ ++
Sbjct  521  SNDILVAALNTPRDRLERFF-------DQQEQR--EGVIIRASQEKLRALSQHAMSAGQR 571
Query  433  TIS--SEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHF 489
                 S   P +L S+   YSN++G++FE   + + QL+++DV+++  ++  GA+ +PH+
Sbjct  572  PWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHY 631
Query  490  NSKAIVVLVINEGEANIELV---GIKEQQ-----QRQQQEEQPL--EVRKYRAELSEQDI 539
            NSKA VV+ + EG    E+     +  Q      +R+Q+EE+    + +K  A L+  DI
Sbjct  632  NSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDI 691
Query  540  FVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSA 597
            FVIPAG+P+ + A+ + N+    FGIN +NNQRNFLAG ++N+I+Q+  + +EL+F    
Sbjct  692  FVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAG-QNNIINQLEREAKELSFNMPR 750
Query  598  KDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSIL 635
            ++IE + + Q ESYFV  + Q +    +GR  PL+SIL
Sbjct  751  EEIEEIFERQVESYFVPMERQSRR--GQGRDHPLASIL 786
 Score = 61.5 bits 243,  Expect = 3e-10
 Identities = 57/173 32%, Positives = 100/173 57%, Gaps = 33/173 19%
Query  3    RARFPLLL-LGVVFLASVSVSFGIAYWE---KQNPSHN---------KCLRSCNSEKDSY 49
            +A+ PL+L L  +FLA V  S+ +   +   + NP H+         +C   C  E+   
Sbjct  4    KAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQQCQERCQHEERGQ 63
Query  50   RN-QACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRP 108
            R  Q C+ RC     E E E E  +I  PR   P ++ +Q   +E  E + PR  P    
Sbjct  64   RQAQQCQRRCEEQLREREREREREEIVDPR--EPRKQYEQC--RETCEKQDPRQQP---- 115
Query  109  RQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKH-----EWQ 163
             Q  +  E + +E++E  R+E + G      + D++E+PR  + + ++ E+H     + Q
Sbjct  116  -QCERRCERQFQEQQERERRERRRG-----RDDDDKENPRDPREQYRQCEEHCRRQGQGQ 169
Query  164  HKQEKHQGKESEEEEEDQDEDEEQDK 189
             +Q++ Q +  E  EE+Q   EE+++
Sbjct  170  RQQQQCQSRCEERFEEEQRRQEERER 195

Sequence Alignment: 21. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 119.5 bits 497,  Expect = 7e-28
 Identities = 205/564 36%, Positives = 359/564 63%, Gaps = 70/564 12%
Query  29   EKQNP-----SHNKCLRSCNSEKDSYRNQA-CHARCNLLKVEEEEECEEGQIPRPRPQHP 82
            +++NP      + +C   C  +    R Q  C+ RC       EE  EE Q    R Q  
Sbjct  7    DEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRC-------EERLEEDQ----RSQE- 54
Query  83   ERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEW--HRKEEKHGGKGSEEE 140
            ERER++ G   +D+   PR  P  R  Q +Q+ E +++ + +    R+ E+   +   E 
Sbjct  55   ERERRR-GRDVDDQN--PRD-PEQRYEQCQQQCERQRRGQEQTLCRRRCEQRRQQEERER 110
Query  141  QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQ 200
            Q  R+   P+Q +++ + + + Q +  + Q +  +  E    E + +++  + S   ES+
Sbjct  111  QRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESR 170
Query  201  REPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNT 260
                 ++  NP++F+S+  ++  +++ G V+ L+RF +R++ L+ + +YR++ +++ PNT
Sbjct  171  GREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNT 230
Query  261  LLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENL 320
             +LPHH DA+ + V+  G A LTLV+ + R+S+NL+ GD +RVPAG T YV+N       
Sbjct  231  SMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQ------ 284
Query  321  RMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQA-QQSYLQGFSKNILEA 379
                         D++E L M+ L  PVN PG+F  ++ +  ++  QSYL+ FS +IL A
Sbjct  285  -------------DSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVA 331
Query  380  SYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--SE 437
            + +T  + + + +        Q E+R  E VI+  S++++R LS+HA S+ ++     S 
Sbjct  332  ALNTPRDRLERFF-------DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSS 382
Query  438  DKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVV 496
              P +L S  P YSN++G++FE   + + QL+++DV+++  ++  GA+ +PH+NSKA VV
Sbjct  383  GGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVV 442
Query  497  LVINEGEANIELV-------GIKEQQQRQQQEEQPL-EVRKYRAELSEQDIFVIPAGYPV 548
            + + EG    E+          + Q +R+Q+EE+     +K  A L+  DIFVIPAG+P+
Sbjct  443  VYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPI 502
Query  549  MVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKS 606
             + A+ + N+  + F IN ENNQR+FLAG ++N+I+Q+  + +EL+F    ++IE + +S
Sbjct  503  AITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLEREAKELSFNMPREEIEEIFES 561
Query  607  QSESYFVDAQPQQKEEGNKGRKGPLSSILR-AFY 639
            Q ESYFV  + Q +    +GR  PL+SIL  AF+
Sbjct  562  QMESYFVPTERQSRR--GQGRDHPLASILDFAFF 593

Sequence Alignment: 22. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 105.6 bits 436,  Expect = 8e-24
 Identities = 173/465 37%, Positives = 308/465 66%, Gaps = 46/465 9%
Query  144  REHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREP 203
            R+   P+Q +++ + + + Q +  + Q +  +  E    E + +++  + S   ES+   
Sbjct  2    RDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESKGRE 61
Query  204  RRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 263
              ++  NP++F+S+  ++  +++ G V+ L+RF +R++ L+ + +YR++ +++ PNT++L
Sbjct  62   EEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFML 121
Query  264  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMI 323
            PHH DA+ +IV+  G A LTLV+ + R+S+NL+ GD +RVPAG T Y             
Sbjct  122  PHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEY------------- 168
Query  324  AGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQA-QQSYLQGFSKNILEASYD 382
                  V+N D++E L M+ L  PVN PG+   ++ +  ++  QSYL+ FS +IL A+ +
Sbjct  169  ------VINQDSNERLEMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALN 222
Query  383  TKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--SEDKP 440
            T  + + + +        Q E+R  E VI+  S++++R LS+HA S+ ++     S   P
Sbjct  223  TPRDRLERFF-------DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGP 273
Query  441  FNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVI 499
             +L S  P YSN++G++FE   + + QL+++DV+++  ++  GA+ +PH+NSKA VV+ +
Sbjct  274  ISLKSERPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYV 333
Query  500  NEGEANIELV-------GIKEQQQRQQQEEQPL-EVRKYRAELSEQDIFVIPAGYPVMVN 551
             EG    E+          ++Q +R+Q+EE+     +K  A L+  DIFVIPAG+P+ + 
Sbjct  334  VEGTGRYEMACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAIT 393
Query  552  ATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSE 609
            A+ + N+  + FGIN ENNQRNFLAG ++++I+Q+  + +EL+F    ++IE + +SQ E
Sbjct  394  ASQNENLRLLGFGINGENNQRNFLAG-QNSIINQLEREAKELSFNMPREEIEEIFESQME 452
Query  610  SYFVDAQPQQKEEGNKGRKGPLSSILR-AFY 639
            SYFV  + Q +    +GR  PL+SIL  AF+
Sbjct  453  SYFVPTERQSRR--GQGRDHPLASILGFAFF 481

Sequence Alignment: 23. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 105.8 bits 437,  Expect = 9e-24
 Identities = 179/557 32%, Positives = 339/557 60%, Gaps = 74/557 13%
Query  9    LLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNLLKVEEEEE 68
            L+L  ++LAS  V+      E ++P   +C   C +++              +  E++E 
Sbjct  9    LVLFALLLASAVVAS-----ESKDPELKQCKHQCKAQQQ-------------ISKEQKEA 50
Query  69   CEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQ--EEEH-EQKEEHEW 125
            C +      R +H     +  G+  E+E    R  P  R R+  +  E++H EQ+EE   
Sbjct  51   CIQACKEYIRQKHQGEHGRGGGDILEEE-VWNRKSPIERLRECSRGCEQQHGEQREECLR 109
Query  126  HRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDE 185
              +EE +  KG +++ +      P  P +K+ ++   Q +++   G  S E  E + E++
Sbjct  110  RCQEEYQREKGRQDDDN------PTDP-EKQYQQCRLQCRRQGEGGGFSREHCERRREEK 162
Query  186  EQDKESQES------EGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNK 238
             ++++ +E       EG E + E   + + + P+ F  + F T F+ Q+G +RVLQ+F  
Sbjct  163  YREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTD 222
Query  239  RSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSG 298
            RS+ L+ + +YR+  + ++P T+++P+H DA+ ++ +  G   ++LV  D R+S N++ G
Sbjct  223  RSELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQG 282
Query  299  DALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFF 358
            D L++ AGTT Y++N DN+E  R++                 +  L  PV+ PG FE FF
Sbjct  283  DILKINAGTTAYLINRDNNE--RLV-----------------LAKLLQPVSTPGEFELFF 323
Query  359  LSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQ 418
             +  +  +S+++ FS  ILEA+++T+ + + ++ FG+   Q+QG       VIV+ S++Q
Sbjct  324  GAGGENPESFFKSFSDEILEAAFNTRRDRLQRI-FGQ---QRQG-------VIVKASEEQ 372
Query  419  IRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEI-TQRNPQLRDLDVFLSVV 477
            +R +S+H +              N+  + P +SN+ G+L E+   +  QLRDLD+ +S+ 
Sbjct  373  VRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLA 432
Query  478  DMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQR---QQQEEQPLEVRKYRAEL 534
            ++ +GA+  PH+NSKA  + ++ +GE   E+      + R   Q +       ++  + L
Sbjct  433  NITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRL 492
Query  535  SEQDIFVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELA 592
            +   + +IPAG+P +  A+S+ N+  + F +NA NN++  LAG + NV++Q+  + +ELA
Sbjct  493  TRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLEREAKELA 551
Query  593  FPRSAKDIENLIKSQSESYFVDAQPQQKEEG 623
            F   A+++E + +SQ E +F    P+Q+++G
Sbjct  552  FGMPAREVEEVSRSQQEEFFFKG-PRQQQQG 581

Sequence Alignment: 24. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 94.0 bits 385,  Expect = 3e-20
 Identities = 161/502 32%, Positives = 283/502 56%, Gaps = 51/502 10%
Query  80   QHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEE 139
            +H  + ++Q+ E+++++  +     +   +   QEEE    EE EW        G+G E 
Sbjct  10   KHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEE----EEEEWGSGR----GRGDEF 61
Query  140  EQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSES 199
               E    R  Q  ++ E +   Q+KQ      + + ++E ++    +D+E +E EG E 
Sbjct  62   STHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEEEEE-EGDEE 120
Query  200  QREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPN 259
            Q E    +++NP+ F  + F T  K + G V VL +F KRS+ L+ L  YR+  + + P 
Sbjct  121  QEE----EDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQ 176
Query  260  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDEN 319
             +++P+H DAD +  +  G   +T +  + R+S N++ GD +R+ AGT FY+VN D +E 
Sbjct  177  AFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEK 236
Query  320  LRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEA 379
            L        Y+V            L  PVN PG +E F     +  +S+ + FS+ +LEA
Sbjct  237  L--------YIVK-----------LLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEA 277
Query  380  SYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK 439
            +  T  +++ K LF          E+  E  IV+ SK+QIR +S+  +  S    + +  
Sbjct  278  ALKTPRDKLEK-LF----------EKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGKST 326
Query  440  -PFNLGSRDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVL 497
              FNL  +DP  SN  G+LFE   ++ P L++LD+ +S V++ +G +  P +NS+A  + 
Sbjct  327  GTFNLFKKDPSQSNNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIA 386
Query  498  VINEGEANIELVGIKEQQQRQQ-QEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDL 556
            ++  GE  +E+        +   QE+     +K  + +    +FV+PAG+P +  A+ + 
Sbjct  387  IVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQ 446
Query  557  NF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVD 614
            N+  + F +NAE N R  LAG K N+I  +  + +ELAF    ++++ +   Q E +F  
Sbjct  447  NLEILCFEVNAEGNIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQ 505
Query  615  AQPQQKEEGNKGR 627
              P+ ++   +GR
Sbjct  506  G-PKWRQH-QQGR 516

Sequence Alignment: 25. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 92.9 bits 380,  Expect = 5e-20
 Identities = 147/430 34%, Positives = 263/430 61%, Gaps = 48/430 11%
Query  159  KHEWQHKQEKHQGKESEEEEEDQDED-----EEQDKESQESEGSESQREPRRHKNKNPFH 213
            K + + K+ KH+ ++  + +E Q  D     EE+ +E Q+ EG+ S+    + + +NP+ 
Sbjct  4    KEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYV 63
Query  214  FNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLI 273
            F  + F++  K + G V+VL+ F KRS+ L  + ++R+  + + P+T++ P H DA+ ++
Sbjct  64   FQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVL 123
Query  274  VILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNP 333
             +  G A +T+V  + R+S+N++ GD +R+PAGT  Y++N   DEN              
Sbjct  124  FVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMIN--RDEN-------------- 167
Query  334  DNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLF 393
               E L ++ +  PV+ PG FE+F+ +  +  +S+ + FS  +LEA+   + E++ KV F
Sbjct  168  ---EKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-F 223
Query  394  GREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRK-TISSEDK-PFNLGSRDPIYS 451
            G    Q +G        IV+ S+++IR LS+H +   R      E   P NL  + P  S
Sbjct  224  GE---QSKGS-------IVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQS 273
Query  452  NKLGKLFEI-TQRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVG 510
            N++G+L+E     + QL+DLD+ +S  ++ +G++  P++NS+A  + V+ EGE   E+  
Sbjct  274  NQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMAC 333
Query  511  IKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNAT--SDLNFFAFGINAENN 568
                      +       K  A L    +FV PAG+PV V A+  ++L  + F +NA  N
Sbjct  334  PHLSSSSGSYQ-------KISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGN 386
Query  569  QRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKG 626
             R  LAG K N++++     +ELAF   ++++E + K+Q +++F     +Q+EEG +G
Sbjct  387  SRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443

Sequence Alignment: 26. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 91.0 bits 372,  Expect = 2e-19
 Identities = 158/454 34%, Positives = 276/454 60%, Gaps = 48/454 10%
Query  141  QDEREHPRPHQ-PHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSES 199
            QD       HQ  HQ++ +++E +H Q        E++  ++ E    ++ S   EG E 
Sbjct  29   QDPELKQCKHQCRHQRQFDEQEKEHCQRSCDEYHIEKKARERAERRRSEEGSSREEGYEE 88
Query  200  QREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPN 259
            +      + +NP+ F  + F+T  +   G ++VL++F KRS+ L+ + ++R+  + + P 
Sbjct  89   EELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQ 148
Query  260  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDEN 319
            T++ P H DA+ ++ +  G A +T V  + R+++N++ GD +R+PAGT  Y++N D +E 
Sbjct  149  TFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEK 208
Query  320  LRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEA 379
            L        Y+V     + LR      PV+ PG FE+F  S  +  +S+ + FS  +LEA
Sbjct  209  L--------YIV-----KILR------PVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEA 249
Query  380  SYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK 439
            +  T+ +++ K LFG+   Q QG       VI++ SK+QIR +SKH +++ R      D 
Sbjct  250  ALKTRRDQLEK-LFGK---QTQG-------VIIKASKEQIRSMSKHEETTPRIWPFGGDS 298
Query  440  --PFNLGSRDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVV 496
              PFNL  + P  SN++G+LFE   +   QL+DLD+ +S  ++ +G++  P++NS+A  +
Sbjct  299  THPFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKI 358
Query  497  LVINEGEANIELV--GIKEQQQRQQQEEQPLEVRKYRAELSEQDI---------FVIPAG 545
             V+ EGE   E+    +     R Q+E      R+ R+  S Q I         FV PAG
Sbjct  359  SVVIEGEGYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAG 418
Query  546  YPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENL 603
            +PV V A+ + N+  + F +NA+ N R  LAG K+N++++   + +ELAF   A+++E +
Sbjct  419  HPVAVIASRNKNLQVLCFDVNAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKI 477
Query  604  IKSQSESYFVDAQPQQKEEGNK 625
             ++Q + +F     +Q EEG +
Sbjct  478  FRNQDQEFFFPGPSRQPEEGGR 499

Sequence Alignment: 27. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 84.8 bits 345,  Expect = 2e-17
 Identities = 165/501 32%, Positives = 291/501 58%, Gaps = 77/501 15%
Query  60   LLKVEEE-EECE-EGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEH 117
            L K++ E ++C+ + ++ R   Q+ E++++Q  ++ E   ++ +     R R+ H+EEE 
Sbjct  23   LAKIDPELKQCKHQCKVQR---QYDEQQKEQCVKECEKYYKEKKG----RERE-HEEEEE 74
Query  118  EQK----EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKE 173
            E      +E   H   EKH        Q  R+  R    +QK+  +   Q + +K +G+ 
Sbjct  75   EWGTGGVDEPSTHEPAEKHLS------QCMRQCERQEGGQQKQLCRFRCQERYKKERGQH 128
Query  174  SEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVL 233
            + + E+D+DEDE++ +E  E                NP+ F  + F T  K + G V +L
Sbjct  129  NYKREDDEDEDEDEAEEEDE----------------NPYVFEDEDFTTKVKTEQGKVVLL 172
Query  234  QRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSY 293
             +F ++S+ L+ L  YR+  + + P  +++P H DAD +  +  G   +T +  + R+S 
Sbjct  173  PKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESI 232
Query  294  NLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGR 353
            N++ GD + + +GT FY+ N  NDEN                 E L ++ +  PVN PG 
Sbjct  233  NVRQGDIVSISSGTPFYIAN--NDEN-----------------EKLYLVQFLRPVNLPGH 273
Query  354  FESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVE 413
            FE F     +  +S+ + FS  ILEA+  T  + + K LF   E Q QG        I++
Sbjct  274  FEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQDQG-------TIMK 322
Query  414  ISKKQIRELSKHAKSSSRKTISSEDK-PFNLGSRDPIYSNKLGKLFEITQRN-PQLRDLD 471
             SK+Q+R +S+  +       + E    F L  +DP  SNK G+LFE  + + P L  LD
Sbjct  323  ASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLD 382
Query  472  VFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYR 531
            + +S  ++ +G + +P +NS+A  + ++  GE  +E   I   +    +  +P   +K R
Sbjct  383  MVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE---IACPHLSSSKSSHP-SYKKLR 438
Query  532  AELSEQDIFVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQ 589
            A + +  +F++PAG+P    A+ + N+    F +NAE N R  LAG K N+I  +  + +
Sbjct  439  ARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAK 497
Query  590  ELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 627
            ELAF    ++++ +   Q E +F    P+ ++E  +GR
Sbjct  498  ELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKE-KEGR 533

Sequence Alignment: 28. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 84.8 bits 345,  Expect = 2e-17
 Identities = 166/501 33%, Positives = 291/501 58%, Gaps = 77/501 15%
Query  60   LLKVEEE-EECE-EGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEH 117
            L K++ E ++C+ + ++ R   Q+ E++++Q  ++ E   ++ +     R R+ H+EEE 
Sbjct  25   LAKIDPELKQCKHQCKVQR---QYDEQQKEQCVKECEKYYKEKKG----RERE-HEEEEE 76
Query  118  EQK----EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKE 173
            E      +E   H   EKH        Q  R+  R    +QK+  +   Q + +K +G+ 
Sbjct  77   EWGTGGVDEPSTHEPAEKHLS------QCMRQCERQEGGQQKQLCRFRCQERYKKERGQH 130
Query  174  SEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVL 233
            + + E+D+DEDE++ +E  E                NP+ F  + F T  K + G V +L
Sbjct  131  NYKREDDEDEDEDEAEEEDE----------------NPYVFEDEDFTTKVKTEQGKVVLL 174
Query  234  QRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSY 293
             +F ++S+ L+ L  YR+  + + P  +++P H DAD +  +  G   +T +  + R+S 
Sbjct  175  PKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESI 234
Query  294  NLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGR 353
            N++ GD + + +GT FY+ N  NDEN                 E L ++ +  PVN PG 
Sbjct  235  NVRQGDIVSISSGTPFYIAN--NDEN-----------------EKLYLVQFLRPVNLPGH 275
Query  354  FESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVE 413
            FE F     +  +S+ + FS  ILEA+  T  + + K LF   E Q QG        I++
Sbjct  276  FEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQDQG-------TIMK 324
Query  414  ISKKQIRELSKHAKSSSRKTISSEDK-PFNLGSRDPIYSNKLGKLFEITQRN-PQLRDLD 471
             SK+QIR +S+  +       + E    F L  +DP  SNK G+LFE  + + P L  LD
Sbjct  325  ASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLD 384
Query  472  VFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYR 531
            + +S  ++ +G + +P +NS+A  + ++  GE  +E   I   +    +  +P   +K R
Sbjct  385  MVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE---IACPHLSSSKSSHP-SYKKLR 440
Query  532  AELSEQDIFVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQ 589
            A + +  +F++PAG+P    A+ + N+    F +NAE N R  LAG K N+I  +  + +
Sbjct  441  ARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAK 499
Query  590  ELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 627
            ELAF    ++++ +   Q E +F    P+ ++E  +GR
Sbjct  500  ELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKE-KEGR 535

Sequence Alignment: 29. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 71.4 bits 286,  Expect = 2e-13
 Identities = 125/399 31%, Positives = 231/399 57%, Gaps = 43/399 10%
Query  193  ESEGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRI 251
            E  G   +R  R   + +NP+ F+S RF+    ++ G +R L  F + S+ L+ +  YR+
Sbjct  47   EEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRV 106
Query  252  LEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYV 311
                 KPNT++LPH+ DA +++ +  G   +  V  ++     L+ GD + VP+G TFY+
Sbjct  107  TCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYL 166
Query  312  VNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQG 371
            VN D+  +LR IA           +  +R           G +E F+++  +  ++    
Sbjct  167  VNNDDHNSLR-IASLL------RTESTMR-----------GEYEPFYVAGGRNPETVYSA 208
Query  372  FSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSR 431
            FS ++LEA+++T  +++  + FG    +++G       VI   +++QIRE+ +    S+ 
Sbjct  209  FSDDVLEAAFNTDVQKLEHI-FG---AHRRG-------VIFYANEEQIREMMRRGGFSAE 257
Query  432  KTISSED-KPFNLGSRDPIYSNKLGKLFEITQR-NPQLRDLDVFLSVVDMNEGALFLPHF 489
             T +SE  KPFNL ++ P + N  G++     + NP L  +DV +    +N G +  P  
Sbjct  258  STSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSH 317
Query  490  NSKAIVVLVINEGEANIELVGIKEQQQR-----QQQEEQPLEVRKYRAELSEQDIFVIPA 544
            N+KA  + ++ EGE  IE+      Q+      +++  Q +   + RA L    ++V+PA
Sbjct  318  NTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPA 377
Query  545  GYPVMVNATSD--LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAF--PRSAKDI 600
            G+P+   A+++  L  + F IN   N+R FLAG K+NV+  +  +V+ L+F  PR  ++I
Sbjct  378  GHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRG-EEI 435
Query  601  ENLIKSQSESYFVDAQPQQKEE 622
            E ++++Q +   +    +Q+ +
Sbjct  436  EEVLQAQKDQVILRGPQRQRRD 457

Sequence Alignment: 30. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 56.8 bits 222,  Expect = 4e-09
 Identities = 107/385 27%, Positives = 199/385 51%, Gaps = 78/385 20%
Query  215  NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIV 274
            NS R   +FK   G +RVL+    R       R   I   + +P +L++P++ D++ +I 
Sbjct  41   NSTR---VFKTDAGEMRVLKSHGGRIFY----RHMHIGFISMEPKSLFVPQYLDSNLIIF 93
Query  275  ILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPD 334
            I  G A L ++ +D+     L++GD   +P+G+ FY+VN    + L +I       ++P 
Sbjct  94   IRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICS-----IDPS 148
Query  335  NDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYD---TKFEEI-NK 390
                L              F+SF++      +S L GF   ILE +++   T  EEI +K
Sbjct  149  TSLGLET------------FQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSK 196
Query  391  VLFG---------------------REEGQQQGEERLQESVIVEISKKQIRELSKHAKSS 429
             L G                     +++ +QQ ++ +Q+    E  K+  R   K  ++ 
Sbjct  197  ELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETV 256
Query  430  SRKT---ISSED---KP--FNL-GSRDPIYSNKLG--KLFEITQRNPQLRDLDVFLSVVD 478
              K    I ++D    P  +NL   +   + N  G  K +   +  P L + D+ + +V 
Sbjct  257  FGKVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEY-PPLSEPDIGVLLVK 315
Query  479  MNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQD 538
            ++ G+++ PH N  +    ++  G   +  +G             P   R  + ++ + D
Sbjct  316  LSAGSMLAPHVNPISDEYTIVLSGYGELH-IGY------------PNGSRAMKTKIKQGD 362
Query  539  IFVIPAGYPVMVNATSD--LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRS 596
            +FV+P  +P    A+ D  L FF F  +A  N+  FLAG+   + + +  ++   AF  S
Sbjct  363  VFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPELSA-AFGVS 421
Query  597  AKDIENLIKSQSESYFV-DAQPQQKEEGNKGRKGPLSSILRAF 638
               +   + +Q E+  +  A     E   K +     + +R+F
Sbjct  422  EDTLRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSF 464

Sequence Alignment: 31. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 50.7 bits 195,  Expect = 3e-07
 Identities = 89/305 29%, Positives = 162/305 53%, Gaps = 36/305 11%
Query  294  NLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDN--DENLRMITLA-IP--- 347
            +++ GD + +PAG   ++ N +    L ++A     V N +N  D+ LR   L   P   
Sbjct  153  HIREGDIIALPAGVAHWIYN-NGQSKLVLVALAD--VGNSENQLDQYLRKFVLGGSPQQE 209
Query  348  VNKPGRFESFFLSSTQAQQS--YLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEER 405
            +   G+  S   SS + QQS   L  F + IL  S++   + + K+   REE Q+    R
Sbjct  210  IQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSFNIDTQLVKKLQ--REEKQRGIIVR 267
Query  406  LQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRN- 464
            ++E + V   ++Q +E S +    +  T++ +    N  SR  +Y+ + G++  I   N 
Sbjct  268  VKEDLQVLSPQRQEKEYSDNGLEETFCTMTLKLN-INDPSRADVYNPRGGRVTSINALNL 326
Query  465  PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQP 524
            P LR L + +    + + A+  PH+N  A  ++ I  G   +++V            E  
Sbjct  327  PILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVS-----------ENG 375
Query  525  LEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LNFFAFGIN--AENNQRNFLAGSKDNVI 581
              V  +  E+ E  + V+P  + V+  A+SD + + +F  N  A+ +Q   LAG + +V+
Sbjct  376  ESV--FDEEIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQ---LAG-RISVM 429
Query  582  SQIPSQVQELAFPRSAKDIENLIKSQSE-SYFVDAQPQQKE 621
              +P  V + +F  S +D  NL +S+SE + F      Q++
Sbjct  430  RGLPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQ 470

Sequence Alignment: 32. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 49.5 bits 190,  Expect = 6e-07
 Identities = 111/399 27%, Positives = 203/399 50%, Gaps = 76/399 19%
Query  195  EGSESQRE---PRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRI 251
            EG E + E   PR  +++  F +  +R + ++K   G VR++  +  R     N     I
Sbjct  36   EGREKRVEEKAPRSPEDRGLFIL--RRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHI 89
Query  252  LEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYV 311
                 +PNTL +P++ DA  ++ +  G A +  +  +      L+SG    +PAG++FY+
Sbjct  90   GFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYI 149
Query  312  VNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQG 371
            VN D  E L +I          D  E++     A P       +SF++      +S L G
Sbjct  150  VNSDKSERLHIICSI-------DTLESMEYYG-AYP-------QSFYVGGGVLPRSVLSG 194
Query  372  FSKNILEASYDTKFEEINKVLFGREEGQ------QQGEERLQESVIVEISKKQIRE---- 421
            F  + L A+++   +++  +L  +  G       +  E+R   S I+++ ++ ++E    
Sbjct  195  FDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMD 254
Query  422  ------------------------LSKHAKSSSRK-TISSEDKPFNLGSRDPIYSNKLGK 456
                                    L K      RK  ++     +NL   +P Y N  G 
Sbjct  255  SDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGY 314
Query  457  LFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQ 515
               I   +   L+  ++ + +V++  GA++ PH N  A    +I  G   I++V      
Sbjct  315  SIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVF----- 369
Query  516  QRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNAT--SDLNFFAFGINAENNQRNFL 573
                    P       A++SE D+F IP  +P    A+  + L FF F  +A  N+  FL
Sbjct  370  --------PNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFL 421
Query  574  AGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRK 628
             G K +++  +       AF  S + +E ++K+Q E+  +   P+++ E   G+K
Sbjct  422  VG-KSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKK 475

Sequence Alignment: 33. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 45.4 bits 172,  Expect = 1e-05
 Identities = 77/261 29%, Positives = 131/261 50%, Gaps = 60/261 22%
Query  19   VSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHA--RCNLLKVEEEEECEEGQIPR 76
            +++  G+ +W   N  + + +     +  +  NQ  +   R +L    EEE+    Q+ R
Sbjct  144  IALPQGVVHW-SYNDGNERVVTINLLDTGNSANQLDNIPRRFHLAGNPEEEQ---RQLRR 199
Query  77   PRPQHPER-ERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKE-------------- 121
               Q   R ER +  E+EE EGE+      P  R  HQEEE + +E              
Sbjct  200  LAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQEEEEQGRESSSCNNLLCAFDRN 259
Query  122  --------EHEWHRKEEK-HGGKGSE-EEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQG 171
                    +H+  RK ++  G +G+    +D  +   P  P  +EEE+ E Q++Q   + 
Sbjct  260  FLAQAFNVDHDIIRKIQRVRGNRGTIIRVRDRLQVVTP--PRMEEEEREERQQEQRYRHT 317
Query  172  KESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVR 231
            +        QD   E+   S   +  E+  +P R    NP              Q G + 
Sbjct  318  RGG-----SQDNGLEETFCSMRIK--ENLADPERADIFNP--------------QAGRIS 356
Query  232  VLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPH-HADADYLIVILNGTAILTLVNNDDR 290
             L RFN    Q   L   R + +N      L+P+ + +A  ++ +L G A + +VN++  
Sbjct  357  TLNRFNLPILQRLELSAERGVLYNRAG---LIPQWNVNAHKILYMLRGCARVQVVNHNGD 413
Query  291  DSY--NLQSGDALRVPAGTTF 309
              +  N++ G  L VP    F
Sbjct  414  AVFDDNVEQGQLLTVPQNFAF 434

Sequence Alignment: 34. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 43.8 bits 165,  Expect = 3e-05
 Identities = 111/413 26%, Positives = 215/413 52%, Gaps = 80/413 19%
Query  186  EQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQN 245
            EQ   SQ+ +  + QR   + + +N   +  KR     +++ G   V + +++  +QLQ 
Sbjct  25   EQVVNSQQRQ--QQQRFQTQCQIQNLNALEPKRR---IESEAG---VTEFWDQNEEQLQC 76
Query  246  LRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLV---------------NNDDR 290
              +  ++    +   LL+P + +A  L+ ++ G+ I   V               +  +R
Sbjct  77   A-NVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETFQEESQSRSRSER 135
Query  291  DSYN---------LQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDN--DENL 339
               +         +Q GD + +PAG   ++ N +    L ++A     V N +N  D+ L
Sbjct  136  SQQSGEQHQKVRPIQEGDVIALPAGVAHWIYN-NGQSKLVLVALAD--VGNSENQLDQYL 192
Query  340  RMITLA-IP---VNKPGRFESFFLSST-----QAQQS--YLQGFSKNILEASYDTKFEEI 388
            R   L   P   +   G+  S   S +     Q QQS   L  F + IL  S++   +  
Sbjct  193  RKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNILSAFDEEILAQSFNIDTQLA 252
Query  389  NKVLFGREEGQQQGE-ERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK------PF 441
             ++   ++E +Q+G   R+QE + V    +Q +E     +   R+    E+        +
Sbjct  253  RRL---QKEKRQRGIIVRVQEDLEVLSPHRQEQEQEYEEERERRQRNGLEETFCTMTLKY 309
Query  442  NLG--SRDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLV 498
            N+   SR  +Y+ + G++  +   N P LR L +      ++  A++ PH+N  A  ++ 
Sbjct  310  NINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVY 369
Query  499  INEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LN 557
            I  G   I++V            E    V  +  E+ E  + V+P  + V+  A+SD + 
Sbjct  370  ITRGNGRIQIVS-----------ENGESV--FDEEIREGQLVVVPQNFAVVKRASSDKFE 416
Query  558  FFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSES--YFVDA 615
            + +F  N  + Q + LAG + +V   +P  V + +F  S +D   L +S+SE+  +   +
Sbjct  417  WVSFKTNGLS-QTSQLAG-RVSVFRALPLDVIKNSFDISREDARRLKESRSETTIFAPGS 474
Query  616  QPQQKEEGNKGRK 628
              Q+K +  + R+
Sbjct  475  SSQRKSQSERERQ 487

Sequence Alignment: 35. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 43.6 bits 164,  Expect = 5e-05
 Identities = 68/289 23%, Positives = 142/289 49%, Gaps = 46/289 15%
Query  82   PERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQ 141
            P+ + QQ  +++EDE ++    P   PR+P     H ++E+ E             +E++
Sbjct  274  PKWQEQQDEDEDEDEDDEDEQIPSHPPRRPS----HGKREQDE-------------DEDE 316
Query  142  DEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQR 201
            DE + PRP +P Q          K+E+ Q     +++ED+DEDE+Q ++S+E    ++Q 
Sbjct  317  DE-DKPRPSRPSQG---------KREQDQ-----DQDEDEDEDEDQPRKSREWRSKKTQ- 360
Query  202  EPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQ-QLQNLRDYRILEFNSKPNT 260
             PRR + + P     +    + +N    +++ +   + S+  + N +  RI  +NS    
Sbjct  361  -PRRPRQEEPRERGCETRNGVEEN-ICTLKLHENIARPSRADFYNPKAGRISTLNSLTLP 418
Query  261  LLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENL 320
             L   +  A Y+++  NG        N +   Y  +    +RV       V + +     
Sbjct  419  ALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQ 478
Query  321  RMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEAS 380
             ++    F V     ++ +  I           F++   + T   +  ++     +L  S
Sbjct  479  LLVVPQNFVVAEQAGEQGFEYIV----------FKTHHNAVTSYLKDVFRAIPSEVLAHS 528
Query  381  YDTKFEEINKVLFGREEGQQQGEERLQESVIVEIS 415
            Y+ +  +++++ +    G     E  Q S  V+++
Sbjct  529  YNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA 563

Sequence Alignment: 36. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 41.8 bits 156,  Expect = 0.0001
 Identities = 52/207 25%, Positives = 104/207 50%, Gaps = 23/207 11%
Query  395  REEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLG--SRDPIYSN 452
            +EE     EE+ Q    VE  K   R+ SK +++   +TI +     N+G  S   IY+ 
Sbjct  271  QEEDDDDEEEQPQ---CVETDKGCQRQ-SKRSRNGIDETICTMRLRQNIGQNSSPDIYNP 326
Query  453  KLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI 511
            + G +   T  + P L  L +      + + A+F+PH+   A  ++    G A +++V  
Sbjct  327  QAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNC 386
Query  512  KEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LNFFAFGINAENNQR 570
              +             R +  EL E  ++++P  + V   + SD + + +F  N   +  
Sbjct  387  NGE-------------RVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIG 433
Query  571  NFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQK 620
            N LAG+ +++++ +P +V +  F   ++    +  +   S++V  Q  Q+
Sbjct  434  N-LAGA-NSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQR 481

Sequence Alignment: 37. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 41.8 bits 156,  Expect = 0.0001
 Identities = 52/207 25%, Positives = 104/207 50%, Gaps = 23/207 11%
Query  395  REEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLG--SRDPIYSN 452
            +EE     EE+ Q    VE  K   R+ SK +++   +TI +     N+G  S   IY+ 
Sbjct  271  QEEDDDDEEEQPQ---CVETDKGCQRQ-SKRSRNGIDETICTMRLRQNIGQNSSPDIYNP 326
Query  453  KLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI 511
            + G +   T  + P L  L +      + + A+F+PH+   A  ++    G A +++V  
Sbjct  327  QAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNC 386
Query  512  KEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LNFFAFGINAENNQR 570
              +             R +  EL E  ++++P  + V   + SD + + +F  N   +  
Sbjct  387  NGE-------------RVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIG 433
Query  571  NFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQK 620
            N LAG+ +++++ +P +V +  F   ++    +  +   S++V  Q  Q+
Sbjct  434  N-LAGA-NSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQR 481

Sequence Alignment: 38. Allergen Name: Tri a gliadin Sequence ID: CAA26383

 Score = 40.8 bits 151,  Expect = 0.0002
 Identities = 25/102 24%, Positives = 59/102 57%, Gaps = 5/102 4%
Query  75   PRPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPH---QEEEHEQKEEHEWHRKE 129
            P+P+ Q P  ++QQ  G++++   +QP P P P P +QP+   Q   + Q    +    +
Sbjct  36   PQPQGQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQ 95
Query  130  EKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEE 176
                       Q + ++P+P+QP  +++ +++ Q++Q+++Q ++ ++
Sbjct  96   PPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQ 142

Sequence Alignment: 39. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 41.5 bits 155,  Expect = 0.0002
 Identities = 84/305 27%, Positives = 160/305 52%, Gaps = 76/305 24%
Query  293  YNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPG 352
            YN++ GD + VP G  +++ N   +E+  ++A +   +++ ++ EN ++  +       G
Sbjct  134  YNFREGDLIAVPTGVAWWMYN---NEDTPVVAVS---IIDTNSLEN-QLDQMPRRFYLAG 186
Query  353  RFESFFLSSTQAQQ------------------SYLQGFSKNILEASYDTKFEEINKVLFG 394
              E  FL   Q Q                   S L GF+   LE ++    ++I K L G
Sbjct  187  NQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQG 245
Query  395  REEGQQQG-------------------EERLQESVIVEISKK-QIRELSKH------AKS 428
              EG+ +G                   ++R QE    E  +K Q +   KH      ++S
Sbjct  246  ENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQS 305
Query  429  SSRK-----TISSEDKPFNLG--SRDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMN 480
             SR+     TI +     N+G  S   IY+ + G +   T  + P L  L +      + 
Sbjct  306  KSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLR 365
Query  481  EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF 540
            + A+F+PH+N  A  ++    G A I++V    +             R +  EL E  ++
Sbjct  366  KNAMFVPHYNLNANSIIYALNGRALIQVVNCNGE-------------RVFDGELQEGRVL 412
Query  541  VIPAGYPVMVNATSD-LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKD 599
            ++P  + V   + SD + + +F  N +      LAG+ +++++ +P +V +  F   ++ 
Sbjct  413  IVPQNFVVAARSQSDNFEYVSFKTN-DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKSQQ 470
Query  600  IENLIKSQSESYFVDAQPQQK 620
               +  +    ++V  Q  QK
Sbjct  471  ARQIKNNNPFKFLVPPQESQK 491

Sequence Alignment: 40. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 41.5 bits 155,  Expect = 0.0002
 Identities = 84/305 27%, Positives = 160/305 52%, Gaps = 76/305 24%
Query  293  YNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPG 352
            YN++ GD + VP G  +++ N   +E+  ++A +   +++ ++ EN ++  +       G
Sbjct  134  YNFREGDLIAVPTGVAWWMYN---NEDTPVVAVS---IIDTNSLEN-QLDQMPRRFYLAG 186
Query  353  RFESFFLSSTQAQQ------------------SYLQGFSKNILEASYDTKFEEINKVLFG 394
              E  FL   Q Q                   S L GF+   LE ++    ++I K L G
Sbjct  187  NQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQG 245
Query  395  REEGQQQG-------------------EERLQESVIVEISKK-QIRELSKH------AKS 428
              EG+ +G                   ++R QE    E  +K Q +   KH      ++S
Sbjct  246  ENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQS 305
Query  429  SSRK-----TISSEDKPFNLG--SRDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMN 480
             SR+     TI +     N+G  S   IY+ + G +   T  + P L  L +      + 
Sbjct  306  KSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLR 365
Query  481  EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF 540
            + A+F+PH+N  A  ++    G A I++V    +             R +  EL E  ++
Sbjct  366  KNAMFVPHYNLNANSIIYALNGRALIQVVNCNGE-------------RVFDGELQEGRVL 412
Query  541  VIPAGYPVMVNATSD-LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKD 599
            ++P  + V   + SD + + +F  N +      LAG+ +++++ +P +V +  F   ++ 
Sbjct  413  IVPQNFVVAARSQSDNFEYVSFKTN-DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKSQQ 470
Query  600  IENLIKSQSESYFVDAQPQQK 620
               +  +    ++V  Q  QK
Sbjct  471  ARQIKNNNPFKFLVPPQESQK 491

Sequence Alignment: 41. Allergen Name: Tri a gliadin Sequence ID: AAA34290

 Score = 40.6 bits 150,  Expect = 0.0002
 Identities = 25/102 24%, Positives = 59/102 57%, Gaps = 5/102 4%
Query  75   PRPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPH---QEEEHEQKEEHEWHRKE 129
            P+P+ Q P  ++QQ  G++++   +QP P P P P +QP+   Q   + Q    +    +
Sbjct  36   PQPQRQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQ 95
Query  130  EKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEE 176
                       Q + ++P+P+QP  +++ +++ Q++Q+++Q ++ ++
Sbjct  96   PPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQQQQ 142

Sequence Alignment: 42. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 36.8 bits 134,  Expect = 0.004
 Identities = 80/307 26%, Positives = 146/307 47%, Gaps = 41/307 13%
Query  293  YNLQSGDALRVPAGTTFYVVNPDNDENL-RMIAGTTFYVVNPDNDENLRMITLA--IPVN 349
            ++L+ GD + +PAG  ++  N D DE+L  ++   T   +N   D+N R   LA  I  +
Sbjct  138  HHLKKGDIIAIPAGVALWCYN-DGDEDLVTVLVQHTASDLN-QLDQNPRHFFLAGNIQRS 195
Query  350  KPGRFESFFLSSTQA--QQSYLQGFS----KNILEASYDTKFEEINKVLFGREEGQQQGE 403
            +  R E + L   Q     + ++GF+     ++L    DT  E   KV   R E  Q+G 
Sbjct  196  QKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDT--ETARKV---RGEDDQRGH 250
Query  404  -ERLQESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLGS--RDPIYSNKLGK 456
              R+++ + V I   +IRE  ++ +        +TI S     N+ +      Y+ + G+
Sbjct  251  IVRVEQGLKV-IRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGR 309
Query  457  LFEITQ-RNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQ 515
            L  +   + P L  L +      + E A+  P +   A  V+    GEA +++V      
Sbjct  310  LTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIV-----D 364
Query  516  QRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAG 575
            +R +          +   L E  + V+P  + V+V       F     N  +N     A 
Sbjct  365  HRGETV--------FDDNLREGQMVVVPQNF-VVVKQAGSRGFEWVVFNTNDNALFSTAA 415
Query  576  SKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEG 623
             + + +  IP  V   A+  S ++   +  ++ E+ +   QP  +  G
Sbjct  416  GRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLF--QPGSRSRG 461

Sequence Alignment: 43. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 37.0 bits 135,  Expect = 0.004
 Identities = 101/410 24%, Positives = 203/410 49%, Gaps = 73/410 17%
Query  163  QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTL 222
            + +Q  +QG++ E+E+E Q   ++Q  E    +G + Q++ R+ + +   +    R Q  
Sbjct  114  ESQQSSQQGRQQEQEQERQ---QQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ 170
Query  223  FKNQYGHVRVLQRFNK--RSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTA 280
             + Q G  +  Q+F +  R Q+ + +R+  ++     P  +    + D D  +V +N   
Sbjct  171  QQGQQGRPQQQQQFRQFDRHQKTRRIREGDVVAI---PAGVAYWSYNDGDQELVAVNLFH 227
Query  281  ILTLVNNDDRDSYNLQSGDALRVPAGTTFYVV-NPDNDENLRMIAGTTFYVVNP-DNDEN 338
            + +  N  D++            P    FY+  NP+N+ N +   G +     P    E 
Sbjct  228  VSSDHNQLDQN------------P--RKFYLAGNPENEFNQQ---GQS----QPRQQGEQ 266
Query  339  LRMITLAIPVNKPGRFE---------SFFLSSTQAQQSYLQGFSKNILEASYDTKFEEI- 388
             R      P  +P + E         S F +   AQ   +   +   L+   D + + I 
Sbjct  267  GRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIR 326
Query  389  --NKVLF-----GREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF 441
                + F     GR+E  ++ EER QE    ++ +++ ++  +   +   +T  S     
Sbjct  327  VRGNLDFVQPPRGRQE--REHEERQQE----QLQQERQQQGGQLMANGLEETFCSLRLKE 380
Query  442  NLGS--RDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLV 498
            N+G+  R  I+S + G++  +   N P LR L +           ++ PH+N  A  V+ 
Sbjct  381  NIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVY 440
Query  499  INEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LN 557
            +  G A +++V         Q             E+ +  +F++P  + V+  A +  + 
Sbjct  441  VIRGNARVQVVNENGDAILDQ-------------EVQQGQLFIVPQNHGVIQQAGNQGFE 487
Query  558  FFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQP 617
            +FAF    EN   N LAG + + +  +P +V   A+  S +    L  ++ E+  + +  
Sbjct  488  YFAFK-TEENAFINTLAG-RTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQ 545
Query  618  QQK 620
            Q++
Sbjct  546  QRR 548

Sequence Alignment: 44. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 36.7 bits 134,  Expect = 0.005
 Identities = 106/407 26%, Positives = 207/407 50%, Gaps = 79/407 19%
Query  163  QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTL 222
            + +Q  +QG++ E+E+E Q   ++Q  E    +G + Q++ R+ + +   +    R Q  
Sbjct  94   ESQQSSQQGRQQEQEQERQ---QQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ 150
Query  223  FKNQYGHVRVLQRFNK--RSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTA 280
             + Q G  +  Q+F +  R Q+ + +R+  ++     P  +    + D D  +V +N   
Sbjct  151  QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAI---PAGVAYWSYNDGDQELVAVNLFH 207
Query  281  ILTLVNNDDRDSYNLQSGDALRVPAGTTFYVV-NPDNDENLRMIAGTTFYVVNP-DNDEN 338
            + +  N  D++            P    FY+  NP+N+ N +   G +     P    E 
Sbjct  208  VSSDHNQLDQN------------P--RKFYLAGNPENEFNQQ---GQS----QPRQQGEQ 246
Query  339  LRMITLAIPVNKPGRFE---------SFFLSSTQAQQ--------SYLQGFSKN---ILE 378
             R      P  +P + E         S F +   AQ           LQG + N   I++
Sbjct  247  GRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQ 306
Query  379  ASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSED 438
               +  F +  +   GR+E  ++ EER QE +  E  ++Q  +L     +   +T  S  
Sbjct  307  VRGNLDFVQPPR---GRQE--REHEERQQEQLQQE-RQQQGEQL---MANGLEETFCSLR 357
Query  439  KPFNLGS--RDPIYSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
               N+G+  R  I+S + G++  +   N P LR L +           ++ PH+N  A  
Sbjct  358  LKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHS 417
Query  496  VLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD 555
            V+ +  G A +++V         +  +  L+      E+ +  +F++P  + V+  A + 
Sbjct  418  VVYVIRGNARVQVVN--------ENGDAILD-----QEVQQGQLFIVPQNHGVIQQAGNQ 464
Query  556  -LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVD 614
             + +FAF    EN   N LAG + + +  +P +V   A+  S +    L  ++ E+  + 
Sbjct  465  GFEYFAFK-TEENAFINTLAG-RTSFLRALPDEVLANAYQISREQARQLKYNRQETIALS 522
Query  615  AQPQQK 620
            +  Q++
Sbjct  523  SSQQRR 528

Sequence Alignment: 45. Allergen Name: Tri a gliadin Sequence ID: AAA34279

 Score = 35.8 bits 129,  Expect = 0.006
 Identities = 23/112 20%, Positives = 62/112 55%, Gaps = 2/112 1%
Query  76   RPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPHQEEEHEQKEEHEWHRKEEKHG 133
            +P+ Q P  ++QQ  G++++   +QP P P P P +QP+ + +   + +    +    + 
Sbjct  34   QPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFLPQLPYPQP 93
Query  134  GKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQ 187
                 ++   ++ P+  QP+Q   +++  Q++Q+++Q ++ ++++  Q   ++Q
Sbjct  94   QSFPPQQPYPQQRPKYLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQ 147

Sequence Alignment: 46. Allergen Name: Tri a gliadin Sequence ID: AAA34278

 Score = 35.3 bits 127,  Expect = 0.008
 Identities = 23/98 23%, Positives = 56/98 57%, Gaps = 5/98 5%
Query  76   RPRPQHPERERQQH-GEKEEDEGEQPRPFPFPRP-RQPH---QEEEHEQKEEHEWHRKEE 130
            +P+ Q P  ++QQ  G++++   +QP P P P P +QP+   Q   + Q    +    + 
Sbjct  37   QPQEQVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQPFPQPQPFPPQLPYPQP 96
Query  131  KHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKE 173
            +         Q + ++ +P+QP  +++ +++ Q++Q+++Q ++
Sbjct  97   QSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQ 139

Sequence Alignment: 47. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 35.8 bits 130,  Expect = 0.009
 Identities = 104/445 23%, Positives = 196/445 44%, Gaps = 76/445 17%
Query  153  HQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF 212
            +Q EE   ++Q    +      E E    +     ++E + +  + S+   RR+  + PF
Sbjct  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
Query  213  HFNSKRFQTLFKNQ----YGHV-----RVLQRFNKRSQQLQNLRDYRILEFNSKP----N 259
            + N+   Q +F  Q    +G +     R  +  + + ++ Q+ R  R L+   +     +
Sbjct  62   YSNAP--QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 119
Query  260  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDAL-------RVP-----AGT 307
            +    H  D   LI +  G A   L N+ D D   +   D         + P     AG 
Sbjct  120  SHQKVHRFDEGDLIAVPTGVAFW-LYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN 178
Query  308  T---FYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQA 364
            T   F      + ++ R     + Y       +  R  +   P  +  R E         
Sbjct  179  TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFS---PRGQHSRRERAGQEEENE 235
Query  365  QQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQG----------------EERLQE 408
              + + GF+   LE ++     +I + L G  E +++G                + R  E
Sbjct  236  GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADE 295
Query  409  SVIVEISKKQIRELSKHAKSSSR-------KTISSEDKPFNLG-SRDP-IYSNKLGKLFE 459
                +  + +  E  +     SR       +TI +     N+G +R P IY+ + G L  
Sbjct  296  EEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKT 355
Query  460  ITQRNPQ-LRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQ 518
                N   LR L       ++   ALF+ H+N+ A  ++    G A++++V         
Sbjct  356  ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGN---- 411
Query  519  QQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LNFFAFGINAENNQRNFLAGSK 577
                     R Y  EL E  ++V+P  + V   + S+ + + AF  ++  +  N LAG +
Sbjct  412  ---------RVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN-LAG-E 460
Query  578  DNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQ 618
            ++VI  +P +V   ++    +    L  +    +FV    Q
Sbjct  461  NSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQ 501

Sequence Alignment: 48. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 35.8 bits 130,  Expect = 0.009
 Identities = 104/445 23%, Positives = 196/445 44%, Gaps = 76/445 17%
Query  153  HQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF 212
            +Q EE   ++Q    +      E E    +     ++E + +  + S+   RR+  + PF
Sbjct  5    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 64
Query  213  HFNSKRFQTLFKNQ----YGHV-----RVLQRFNKRSQQLQNLRDYRILEFNSKP----N 259
            + N+   Q +F  Q    +G +     R  +  + + ++ Q+ R  R L+   +     +
Sbjct  65   YSNAP--QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 122
Query  260  TLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDAL-------RVP-----AGT 307
            +    H  D   LI +  G A   L N+ D D   +   D         + P     AG 
Sbjct  123  SHQKVHRFDEGDLIAVPTGVAFW-LYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN 181
Query  308  T---FYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQA 364
            T   F      + ++ R     + Y       +  R  +   P  +  R E         
Sbjct  182  TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFS---PRGQHSRRERAGQEEENE 238
Query  365  QQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQG----------------EERLQE 408
              + + GF+   LE ++     +I + L G  E +++G                + R  E
Sbjct  239  GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADE 298
Query  409  SVIVEISKKQIRELSKHAKSSSR-------KTISSEDKPFNLG-SRDP-IYSNKLGKLFE 459
                +  + +  E  +     SR       +TI +     N+G +R P IY+ + G L  
Sbjct  299  EEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKT 358
Query  460  ITQRNPQ-LRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQ 518
                N   LR L       ++   ALF+ H+N+ A  ++    G A++++V         
Sbjct  359  ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGN---- 414
Query  519  QQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSD-LNFFAFGINAENNQRNFLAGSK 577
                     R Y  EL E  ++V+P  + V   + S+ + + AF  ++  +  N LAG +
Sbjct  415  ---------RVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN-LAG-E 463
Query  578  DNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQ 618
            ++VI  +P +V   ++    +    L  +    +FV    Q
Sbjct  464  NSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQ 504

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.