The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFN
KRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHP
GDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNI
LETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPF
NLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN
EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLA
FGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQK
EEGSKGRKGPFPSILGALY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB23463 Gly m conglycinin 439 2855 657.1 4.9e-190
Q9FZP9 Gly m 5.0201 559 2109 487.0 1e-138
O22120 Gly m 5.0101 543 2108 486.8 1.1e-138
CAA35691 Gly m conglycinin 605 2108 486.8 1.3e-138
Q198W3 Vig r 2.0101 453 1917 443.3 1.2e-125
B1NPN8 Vig r 2.0201 454 1882 435.3 3e-123
AAB01374 Gly m conglycinin 639 1583 367.1 1.4e-102
AAA33947 Gly m conglycinin 218 1184 276.5 9.2e-76
AAM54366 Jug n 2 481 964 226.0 3.1e-60
AAF18269 Jug r 2 593 958 224.6 1e-59
Q9SPL4 Mac i 1.0201 666 957 224.4 1.4e-59
Q9SPL3 Mac i 1.0101 625 956 224.2 1.5e-59
AAK15089 Ses i 3 585 848 199.6 3.6e-52
EF116865 Pis v 3.0101 519 817 192.5 4.2e-50
A0A2I4E5L6 Jug r 6.0101 502 812 191.4 8.8e-50
B3STU4 Car i 2.0101 792 807 190.2 3.2e-49
P09801 Gos h 1 588 774 182.7 4.3e-47
V9VGU0 Pin k 2.0101 463 737 174.3 1.1e-44
P09799 Gos h 2 605 731 172.9 3.9e-44
ACB05815 Lup an 1.0101 611 720 170.4 2.3e-43
CAD87730 Len c 1.0101 418 694 164.5 8.9e-42
CAF25232 Pis s 1.0101 415 674 160.0 2.1e-40
CAD87731 Len c 1.0102 415 671 159.3 3.3e-40
AAM73730 Ana o 1.0101 538 663 157.4 1.6e-39
AAM73729 Ana o 1.0102 536 662 157.2 1.9e-39
CAF25233 Pis s 1.0102 415 657 156.1 3.1e-39
P43237 Ara h 1 614 645 153.3 3.2e-38
P43238 Ara h 1 626 645 153.3 3.3e-38
AAL86739 Cor a 11 448 627 149.2 3.8e-37
BAB21619 Gly m Bd28K 473 228 58.3 9.7e-10
A0A0S3B0K0 Coc n 1.0101 490 185 48.5 9.1e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 657.1 bits 2855,  Expect = 5e-190
 Identities = 439/439 100%, Positives = 439/439 100%, Gaps = 0/439 0%
Query  1    MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFN 60
            MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFN
Sbjct  1    MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFN 60
Query  61   KRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHP 120
            KRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHP
Sbjct  61   KRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHP 120
Query  121  GDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNI 180
            GDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNI
Sbjct  121  GDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNI 180
Query  181  LETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPF 240
            LETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPF
Sbjct  181  LETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPF 240
Query  241  NLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN 300
            NLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN
Sbjct  241  NLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN 300
Query  301  EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLA 360
            EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLA
Sbjct  301  EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLA 360
Query  361  FGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQK 420
            FGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQK
Sbjct  361  FGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQK 420
Query  421  EEGSKGRKGPFPSILGALY 439
            EEGSKGRKGPFPSILGALY
Sbjct  421  EEGSKGRKGPFPSILGALY 439

Sequence Alignment: 2. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 487.0 bits 2109,  Expect = 1e-138
 Identities = 317/412 76%, Positives = 372/412 90%, Gaps = 6/412 1%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R    NPF+F +S  FQTLF+NQ   +R+LQRFNKRS QL+NLRDYRI++F SKPNT+LL
Sbjct  143  RHKNKNPFHF-NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 201
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            PHHADAD+L+ +L+G AILTLVNNDDRDSYNL+ GDA R+PAGTTYY+VNP + +NL++I
Sbjct  202  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMI 261
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEE----- 201
             LAIPVNKPGR++ FFLSSTQAQQSYLQGFS NILE S+ ++FEEIN+VLFG EE     
Sbjct  262  TLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQG 321
Query  202  EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITP 261
            E+R QE VIVE+SK+QIR+LS+ AKSSSRKTISSED+PFNLRSR+PIYSN +GK+FEITP
Sbjct  322  EERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITP 381
Query  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQE 321
            EKNPQLRDLD+FLS VD+NEGAL+LPHFNSKAIV+LVINEG+ANIELVGIKEQQQ+Q+QE
Sbjct  382  EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQE 441
Query  322  EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
            E+PLEV++YRAELSE D+FVIPA YP VVNATS+LNF+AFGINAENNQRNFLAG KDNV+
Sbjct  442  EQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDNVI 501
Query  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439
             QI  QVQELAFPGSA+D+E L+K Q ESYFVDAQPQQKEEG+KGRKGP+ SIL A+Y
Sbjct  502  SQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY 559

Sequence Alignment: 3. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 486.8 bits 2108,  Expect = 1e-138
 Identities = 320/412 77%, Positives = 372/412 90%, Gaps = 6/412 1%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R    NPF F  SN F+TLF+NQ  RIR+LQRFN+RSPQL+NLRDYRI++F SKPNT+LL
Sbjct  127  RHKNKNPFLF-GSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLL 185
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P+HADAD+L+ +L+G AIL+LVNNDDRDSY L+ GDA R+P+GTTYY+VNP +++NL++I
Sbjct  186  PNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLI 245
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEE----- 201
             LAIPVNKPGR++ FFLSST+AQQSYLQGFS NILE S+ ++FEEIN+VLF  EE     
Sbjct  246  TLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQG 305
Query  202  EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITP 261
            EQR QE VIVE+SKEQIR LS+RAKSSSRKTISSED+PFNLRSR+PIYSN +GKFFEITP
Sbjct  306  EQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITP 365
Query  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQE 321
            EKNPQLRDLDIFLS VD+NEGALLLPHFNSKAIVILVINEGDANIELVG+KEQQQ+Q+QE
Sbjct  366  EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE 425
Query  322  EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
            E+PLEV++YRAELSE D+FVIPA YP VVNATSNLNF+A GINAENNQRNFLAG +DNV+
Sbjct  426  EQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVI 485
Query  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439
             QI  QVQELAFPGSAQ VE+LLK QRESYFVDAQP++KEEG+KGRKGP+ SIL A+Y
Sbjct  486  SQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 543

Sequence Alignment: 4. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 486.8 bits 2108,  Expect = 1e-138
 Identities = 320/412 77%, Positives = 372/412 90%, Gaps = 6/412 1%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R    NPF F  SN F+TLF+NQ  RIR+LQRFN+RSPQL+NLRDYRI++F SKPNT+LL
Sbjct  189  RHKNKNPFLF-GSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLL 247
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P+HADAD+L+ +L+G AIL+LVNNDDRDSY L+ GDA R+P+GTTYY+VNP +++NL++I
Sbjct  248  PNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLI 307
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEE----- 201
             LAIPVNKPGR++ FFLSST+AQQSYLQGFS NILE S+ ++FEEIN+VLF  EE     
Sbjct  308  TLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQG 367
Query  202  EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITP 261
            EQR QE VIVE+SKEQIR LS+RAKSSSRKTISSED+PFNLRSR+PIYSN +GKFFEITP
Sbjct  368  EQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITP 427
Query  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQE 321
            EKNPQLRDLDIFLS VD+NEGALLLPHFNSKAIVILVINEGDANIELVG+KEQQQ+Q+QE
Sbjct  428  EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE 487
Query  322  EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
            E+PLEV++YRAELSE D+FVIPA YP VVNATSNLNF+A GINAENNQRNFLAG +DNV+
Sbjct  488  EQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVI 547
Query  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439
             QI  QVQELAFPGSAQ VE+LLK QRESYFVDAQP++KEEG+KGRKGP+ SIL A+Y
Sbjct  548  SQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY 605

Sequence Alignment: 5. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 443.3 bits 1917,  Expect = 1e-125
 Identities = 306/433 70%, Positives = 376/433 86%, Gaps = 26/433 6%
Query  1    MMRVRFPLLVLLGTVFLASVCVSLKV--REDE-----------NNPFYFRSSNSFQTLFE 47
            M+R R  LL  LG +FLAS+ VS+ +  RE +           NNPFYF S   F+TLF+
Sbjct  1    MVRARVQLL--LGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFK 58
Query  48   NQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTL 107
            NQ   +R+++RF++RS Q++NL +YR+V+F+SKPNT+LLPHHADADFLL VL+GRAILTL
Sbjct  59   NQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTL 118
Query  108  VNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQ 167
            VN D RDSY L  G AQ+IPAGTT++LVNP+D+ NL+IIKLAIPVN P R+ +FFLSST+
Sbjct  119  VNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTE 178
Query  168  AQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQR-----QQEGVIVELSKEQIRQLS 222
            AQQSYL+GFS NILE SF S+F+EI+RVLFGEE +Q+     Q+EGVIVEL +EQIR+L 
Sbjct  179  AQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELI 238
Query  223  RRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEG 282
            + AKSSSRK +SS+DEPFNLR+ NPIYSN FG+++EITPEKNPQL+DLD+F+SSVD+ EG
Sbjct  239  KHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEG 298
Query  283  ALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVI 342
             LLLPH+NSKAIVILVINEG+A IELVG  +QQQ+    +E LEVQRYRAELSEDDVFVI
Sbjct  299  GLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYRAELSEDDVFVI 354
Query  343  PAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVER 402
            PAAYP  +NATSNLNF+AFGINAENNQRNFLAGEKDNV+ +I  +V +++FP S   VE+
Sbjct  355  PAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEK 414
Query  403  LLKKQRESYFVDAQP--QQKEEGSKGRKGPFPSILGALY 439
            L+KKQ ES+FVDAQP  QQ+EEG KGRKG + SILG+LY
Sbjct  415  LIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY 453

Sequence Alignment: 6. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 435.3 bits 1882,  Expect = 3e-123
 Identities = 298/431 69%, Positives = 372/431 86%, Gaps = 21/431 4%
Query  1    MMRVRFPLLVLLGTVFLASVCVSLKV--RED-----------ENNPFYFRSSNSFQTLFE 47
            M+R R PLL+LLG +FLAS+ VS+ +  RE+           +NNPFYF S   F+TLF 
Sbjct  1    MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR 60
Query  48   NQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTL 107
            NQ   +R+LQRF++RS Q++NL +YR+V++ SKPNT+LLPHHADADFLL VL+GRA+LTL
Sbjct  61   NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL 120
Query  108  VNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQ 167
            VN D RDS  L  G AQ+IPAGTT++LVNP D++NL+IIKLA+PVN P R+ DFFLSST+
Sbjct  121  VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE 180
Query  168  AQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ------EGVIVELSKEQIRQL 221
            AQQSYLQGFS NILE SF S+ +EI+RVLFGEE +Q+QQ      EGVIVEL +EQIR+L
Sbjct  181  AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL 240
Query  222  SRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINE 281
            ++ AKSSS+K++SSED+PFNLR++ PIYSN +G++FEITPEKNPQLRDLD+F+ SVD+ E
Sbjct  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
Query  282  GALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFV 341
            G+LLLPH+NSKAIVILVINEG ANIELVG +EQQ++Q+++EE  EVQRYRAELSEDDVF+
Sbjct  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
Query  342  IPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE 401
            IPA YP  +NATSNLNF+AFGINAENNQRNFLAGEKDNV+ +I  +V ++ FP S + V+
Sbjct  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
Query  402  RLLKKQRESYFVDAQPQQ--KEEGSKGRKGPF 431
            +L+KKQ ES FVDAQP+Q  +EE  KG KGPF
Sbjct  421  KLIKKQSESQFVDAQPEQQEREEARKGGKGPF 452

Sequence Alignment: 7. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 367.1 bits 1583,  Expect = 1e-102
 Identities = 310/411 75%, Positives = 369/411 89%, Gaps = 26/411 6%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R    NPF+F +S  FQTLF+NQ   +R+LQRFNKRS QL+NLRDYRI++F SKPNT+LL
Sbjct  205  RHKNKNPFHF-NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLL 263
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            PHHADAD+L+ +L+G AILTLVNNDDRDSYNL+ GDA R+PAGTT+Y+VNP + +NL++I
Sbjct  264  PHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMI 323
Query  147  K-------------------LAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHS 187
                                LAIPVNKPGR++ FFLSSTQAQQSYLQGFS NILE S+ +
Sbjct  324  AGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDT 383
Query  188  EFEEINRVLFGEEE-----EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNL 242
            +FEEIN+VLFG EE     E+R QE VIVE+SK+QIR+LS+ AKSSSRKTISSED+PFNL
Sbjct  384  KFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNL 443
Query  243  RSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEG 302
             SR+PIYSN +GK+FEIT ++NPQLRDLD+FLS VD+NEGAL+LPHFNSKAIV+LVINEG
Sbjct  444  GSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEG 502
Query  303  DANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFG 362
            +ANIELVGIKEQQQ+Q+QEE+PLEV++YRAELSE D+FVIPA YP +VNATS+LNF+AFG
Sbjct  503  EANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFG 562
Query  363  INAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEE 422
            INAENNQRNFLAG KDNV+ QI  QVQELAFP SA+D+E L+K Q ESYFVDAQPQQKEE
Sbjct  563  INAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEE 622
Query  423  GSKGRKGPFPSILGALY 439
            G+KGRKGP+ SIL A+Y
Sbjct  623  GNKGRKGPLSSILRAFY 639

Sequence Alignment: 8. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 276.5 bits 1184,  Expect = 9e-76
 Identities = 181/218 83%, Positives = 201/218 92%, Gaps = 0/218 0%
Query  222  SRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINE 281
            S+RAKSSSRKTISSED+PFNL SR+PIYS  +GKFFEITPEKNPQLRDLDIFLS VD+NE
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  282  GALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFV 341
            GALLLPHFNSKAIVILVINEGDANIELVG+KEQQQ+Q+QEE+PLEV++YRAELSE D+FV
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV 120
Query  342  IPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE 401
            IPA YP VVNATSNLNF+A GINAENNQRNFLAG +DNV+ QI  QVQELAFPGSAQ VE
Sbjct  121  IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE 180
Query  402  RLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY 439
            +LLK QRESYFVDAQP +KEEG+KGRKGP+ SIL A+Y
Sbjct  181  KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY 218

Sequence Alignment: 9. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 226.0 bits 964,  Expect = 3e-60
 Identities = 165/404 40%, Positives = 279/404 69%, Gaps = 24/404 5%
Query  25   KVREDE---NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKP 81
            K RE+E   +NP+YF S  S ++  E++   ++ L+RF +R+  L  + +YR+V + + P
Sbjct  58   KGREEEQQRHNPYYFHSQ-SIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANP 116
Query  82   NTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQ 141
            NT +LPHH DA+ ++ V  GRA LTLV+ + R+S+NL  GD  R+PAG T Y++N   ++
Sbjct  117  NTFMLPHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNE 176
Query  142  NLKIIKLAIPVNKPGRYDDFFLSSTQA-QQSYLQGFSHNILETSFHSEFEEINRVLFGEE 200
             L+++KL  PVN PG+  +++ +  ++  QSYL+ FS++IL  ++++  + + R  F ++
Sbjct  177  RLEMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER--FFDQ 234
Query  201  EEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTIS--SEDEPFNLRSRNPIYSNNFGKFFE 258
            +EQR  EGVI+  S+E++R LS+ A S+ ++     S   P +L+S  P YSN FG+FFE
Sbjct  235  QEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFE 292
Query  259  ITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV-------GI 311
              PE++ QL+++D++++  +I  GA+++PH+NSKA V++ + EG    E+          
Sbjct  293  ACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSF 352
Query  312  KEQQQKQKQEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNF--LAFGINAENN 368
            ++Q +++++EEE     Q+  A L+  D+FVIPA +P  + A+ N N+  L FGIN ENN
Sbjct  353  EDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENN 412
Query  369  QRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRK 428
            QRNFLAG+ ++++ Q+ER+ +EL+F    +++E +++ Q ESYFV  + Q +    +GR 
Sbjct  413  QRNFLAGQ-NSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRD 469
Query  429  GPFPSILG 436
             P+ SILG
Sbjct  470  HPLASILG 477

Sequence Alignment: 10. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 224.6 bits 958,  Expect = 1e-59
 Identities = 164/401 40%, Positives = 275/401 68%, Gaps = 24/401 5%
Query  27   REDE---NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNT 83
            RE+E   +NP+YF S  S ++  E++   ++ L+RF +R+  L  + +YR+V + + PNT
Sbjct  172  REEEQQRHNPYYFHSQ-SIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNT 230
Query  84   ILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNL 143
             +LPHH DA+ +  V  GRA LTLV+ + R+S+NL  GD  R+PAG T Y++N   ++ L
Sbjct  231  SMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERL 290
Query  144  KIIKLAIPVNKPGRYDDFFLSSTQA-QQSYLQGFSHNILETSFHSEFEEINRVLFGEEEE 202
            +++KL  PVN PG++ +++ +  ++  QSYL+ FS++IL  ++++  + + R  F +++E
Sbjct  291  EMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER--FFDQQE 348
Query  203  QRQQEGVIVELSKEQIRQLSRRAKSSSRKTIS--SEDEPFNLRSRNPIYSNNFGKFFEIT 260
            QR  EGVI+  S+E++R LS+ A S+ ++     S   P +L+S +P YSN FG+FFE  
Sbjct  349  QR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEAC 406
Query  261  PEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIK------EQ 314
            PE++ QL+++D++++  +I  GA+++PH+NSKA V++ + EG    E+          E 
Sbjct  407  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEG 466
Query  315  QQKQKQEEEPL--EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQR 370
            Q +++QEEE      Q+  A L+  D+FVIPA +P  + A+ N N+  L F IN ENNQR
Sbjct  467  QGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQR 526
Query  371  NFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGP 430
            +FLAG+ +N++ Q+ER+ +EL+F    +++E +++ Q ESYFV  + Q +    +GR  P
Sbjct  527  DFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRDHP 583
Query  431  FPSIL 435
            + SIL
Sbjct  584  LASIL 588

Sequence Alignment: 11. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 224.4 bits 957,  Expect = 1e-59
 Identities = 160/398 40%, Positives = 260/398 65%, Gaps = 22/398 5%
Query  31   NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHA 90
            +NP+YF    S+ T F  +   I +L+ F  RS  L  L++YR+V +++ PN  +LP H 
Sbjct  249  DNPYYF-DERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHL 307
Query  91   DADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI 150
            DAD +L+V  GR  L +++ D+R+SYNL  GD  RIPAGTT+YL+N  +++ L I K+  
Sbjct  308  DADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQ 367
Query  151  PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI 210
             ++ PG+Y +FF +  Q  + YL  FS  ILE +++++ E +  VL G+     Q+EGVI
Sbjct  368  TISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-GQ-----QREGVI 421
Query  211  VELSKEQIRQLSRRAKSSSRKTISSEDE----PFNLRSRNPIYSNNFGKFFEITPEKNPQ 266
            +  S+EQIR+L+R    S R  I    E    P+NL ++ P+YSN +G+ +E+ PE   Q
Sbjct  422  ISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQ 481
Query  267  LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV-----GIKEQQQ--KQK 319
            L+D+D+ +   +I +G+++ P FN+++  ++V+  G+A++E+      G    ++  K+ 
Sbjct  482  LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRH 541
Query  320  QEEEPLEVQRYRAELSEDDVFVIPAAYP--FVVNATSNLNFLAFGINAENNQRNFLAGEK 377
            +EEE +  ++ +A LS+ +  V+P  +P  FV +   NL ++AFGINA+NN+ NFLAG +
Sbjct  542  EEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRE 601
Query  378  DNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKG--PFPSIL 435
             NV++QIE Q  ELAF    ++VE L+  Q ES F     Q++++ S+  K   P+ SIL
Sbjct  602  RNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661

Sequence Alignment: 12. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 224.2 bits 956,  Expect = 1e-59
 Identities = 162/398 40%, Positives = 259/398 65%, Gaps = 22/398 5%
Query  31   NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHA 90
            +NP+YF    S+ T F  +   I +L+ F  RS  L  L++YR+V +++ PN  +LP H 
Sbjct  208  DNPYYF-DERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHL 266
Query  91   DADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI 150
            DAD +L+V+ GR  L +++ D+R+SYNL  GD  RIPAGTT+YL+N  +++ L I K+  
Sbjct  267  DADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQ 326
Query  151  PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI 210
             ++ PG+Y +FF +  Q  + YL  FS  ILE +++++ E +  VL G+     Q+EGVI
Sbjct  327  TISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL-GQ-----QREGVI 380
Query  211  VELSKEQIRQLSRRAKSSSRKTISSEDE----PFNLRSRNPIYSNNFGKFFEITPEKNPQ 266
            +  S+EQIR+L+R    S R  I    E    P+NL ++ P+YSN +G+ +E+ PE   Q
Sbjct  381  IRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQ 440
Query  267  LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQ-------KQK 319
            L+D+D+ +   +I +G+++ P FN+++  ++V+  G+A++E+       +       K+ 
Sbjct  441  LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRH 500
Query  320  QEEEPLEVQRYRAELSEDDVFVIPAAYP--FVVNATSNLNFLAFGINAENNQRNFLAGEK 377
            +EEE +  ++ RA LS+ +  V+ A +P  FV +   NL ++AFGINA+NN+ NFLAG +
Sbjct  501  EEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRE 560
Query  378  DNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDA--QPQQKEEGSKGRKGPFPSIL 435
             NV++QIE Q  ELAF  S ++VE L+  Q ES F     Q QQ+   S  ++ P+ SIL
Sbjct  561  RNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSIL 620

Sequence Alignment: 13. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 199.6 bits 848,  Expect = 4e-52
 Identities = 141/382 36%, Positives = 237/382 62%, Gaps = 14/382 3%
Query  33   PFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADA 92
            P+ F   + F T F  Q+ R+R+LQ+F  RS  L  + +YR+  ++++P T ++P+H DA
Sbjct  195  PYVFEDQH-FITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDA 253
Query  93   DFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPV 152
            + ++FV  GR  ++LV  D R+S N+  GD  +I AGTT YL+N  +++ L + KL  PV
Sbjct  254  ESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPV 313
Query  153  NKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVE 212
            + PG ++ FF +  +  +S+++ FS  ILE +F++  + + R+ FG+   QRQ  GVIV+
Sbjct  314  STPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRI-FGQ---QRQ--GVIVK 367
Query  213  LSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDI 272
             S+EQ+R +SR  +              N+  + P +SN +G++ E+   +  QLRDLD+
Sbjct  368  ASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDL 427
Query  273  FLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPL---EVQR 329
             +S  +I +GA+  PH+NSKA  I ++ +G+   E+      + +   + E       QR
Sbjct  428  TVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQR 487
Query  330  YRAELSEDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQRNFLAGEKDNVVRQIERQ 387
              + L+   V +IPA +PFV  A+SN N+  L F +NA NN++  LAG + NV+ Q+ER+
Sbjct  488  VASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQLERE 546
Query  388  VQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEG 423
             +ELAF   A++VE + + Q+E +F    P+Q+++G
Sbjct  547  AKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQG 581

Sequence Alignment: 14. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 192.5 bits 817,  Expect = 4e-50
 Identities = 138/390 35%, Positives = 234/390 60%, Gaps = 14/390 3%
Query  28   EDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLP 87
            E++ NP+ F   + F T  + +  ++ +L +F KRS  L  L  YR+  + + P   ++P
Sbjct  123  EEDENPYVFEDEH-FTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVP 181
Query  88   HHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIK 147
            +H DAD ++FV  GR  +T +  + R+S N+  GD  RI AGT +Y+VN  +++ L I+K
Sbjct  182  NHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVK 241
Query  148  LAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQE 207
            L  PVN PG Y+ F     +  +S+ + FS  +LE ++ +  +++ + LF     ++Q E
Sbjct  242  LLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LF-----EKQDE 295
Query  208  GVIVELSKEQIRQLSRRAKSSSRKTISSEDE-PFNLRSRNPIYSNNFGKFFEITPEKNPQ 266
            G IV+ SKEQIR +SRR +  S    + +    FNL  ++P  SNN+G++FE   +  P 
Sbjct  296  GAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPP 355
Query  267  LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQK-QEEEPL 325
            L++LDI +S V+I +G +  P +NS+A  I ++  G+  +E+        K   QE+   
Sbjct  356  LQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGP 415
Query  326  EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQRNFLAGEKDNVVRQ 383
              ++  + +  D VFV+PA +PFV  A+ N N+  L F +NAE N R  LAG+K N++  
Sbjct  416  SYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKK-NIIEV 474
Query  384  IERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGR 427
            +E++ +ELAF    ++V++++ KQ E +F    P+ ++   +GR
Sbjct  475  MEKEAKELAFKTKGEEVDKVFGKQDEEFFFQG-PKWRQH-QQGR 516

Sequence Alignment: 15. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 191.4 bits 812,  Expect = 9e-50
 Identities = 144/389 37%, Positives = 246/389 63%, Gaps = 26/389 6%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            RE+EN P+ F   + F+T       RI++L++F KRS  L  + ++R+  +++ P T + 
Sbjct  95   REEEN-PYVFEDED-FETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTFIS 152
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P H DA++++FV  GRA +T V  + R+++N+  GD  RIPAGT  YL+N  +++ L I+
Sbjct  153  PAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEKLYIV 212
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
            K+  PV+ PG ++ F  S  +  +S+ + FS  +LE ++ +  +++ + LFG     +Q 
Sbjct  213  KILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEK-LFG-----KQT 266
Query  207  EGVIVELSKEQIRQLSRRAKSSSRKTISSED--EPFNLRSRNPIYSNNFGKFFEITPEKN 264
            +GVI++ SKEQIR +S+  +++ R      D   PFNL  + P  SN FG++FE  P++ 
Sbjct  267  QGVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFGRLFETDPKEC 326
Query  265  PQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV-------GIKEQQQ- 316
             QL+DLD+ +S  +I +G++  P++NS+A  I V+ EG+   E+        G + Q++ 
Sbjct  327  KQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQREG 386
Query  317  ----KQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQR 370
                +++    P   Q+ R  L    VFV PA +P  V A+ N N+  L F +NA+ N R
Sbjct  387  SGSSRRRSRSGP-SYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGNIR 445
Query  371  NFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSK 425
              LAG K+N+V + E++ +ELAF   A++VE++++ Q + +F     +Q EEG +
Sbjct  446  FPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEEGGR 499

Sequence Alignment: 16. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 190.2 bits 807,  Expect = 3e-49
 Identities = 160/401 39%, Positives = 277/401 69%, Gaps = 25/401 6%
Query  27   REDE---NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNT 83
            RE+E   +NP+YF S   +++  E+    ++ L+RF +R+  L  + +YR+V +++ PNT
Sbjct  369  REEEQQRHNPYYFHSQG-LRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNT 427
Query  84   ILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNL 143
             +LP+H DA+ ++ V  GRA LT+V+ + R+S+NL  GD  R+PAG T Y++N   ++ L
Sbjct  428  FVLPYHKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERL 487
Query  144  KIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQ 203
            +++KL  PVN PG++ +++ +  Q+ +SYL+ FS++IL  ++++  + + R  F +++EQ
Sbjct  488  EMVKLLQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLER--FFDQQEQ 545
Query  204  RQQEGVIVELSKEQIRQLSRRAKSSSRKTIS--SEDEPFNLRSRNPIYSNNFGKFFEITP 261
            R  EGVI+  S+E++R LS+ A S+ ++     S   P +L+S+   YSN FG+FFE  P
Sbjct  546  R--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACP 603
Query  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV---GIKEQQQKQ 318
            E++ QL+++D++++  +I  GA+++PH+NSKA V++ + EG    E+     +  Q  + 
Sbjct  604  EEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEY 663
Query  319  K----QEEEPL---EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQ 369
            K    QEEE     + Q+  A L+  D+FVIPA +P  + A+ N N+  + FGIN +NNQ
Sbjct  664  KGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQ 723
Query  370  RNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKG 429
            RNFLAG+ +N++ Q+ER+ +EL+F    +++E ++++Q ESYFV  + Q +    +GR  
Sbjct  724  RNFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPMERQSRR--GQGRDH 780
Query  430  PFPSIL 435
            P+ SIL
Sbjct  781  PLASIL 786

Sequence Alignment: 17. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 182.7 bits 774,  Expect = 4e-47
 Identities = 164/392 41%, Positives = 264/392 67%, Gaps = 26/392 6%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            +E  +NPF+F    SFQ+ F  ++   R+LQRF  R P L  + ++R+  +++ PNT +L
Sbjct  175  QEQSHNPFHFHRR-SFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVL 233
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            PHH DA+ + +V +GR  LT++ +++++SYN+ PG   R+PAG+T YL N  + + L I 
Sbjct  234  PHHCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA 293
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
             L  PVN P ++++FF + +Q  QSYL+ FS  ILE +F++  E+++ ++ G +  +RQQ
Sbjct  294  VLHRPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQ 353
Query  207  -EGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNP 265
             +G+  + S+EQIR LS+ A S   K  S E   FNL  R P YSN  G+F+E  P +  
Sbjct  354  GQGMFRKASQEQIRALSQEATSPREK--SGERFAFNLLYRTPRYSNQNGRFYEACPREFR 411
Query  266  QLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGI-----------KEQ 314
            QL D+++ +S++ +N+G++++PH+NSKA  ++++NEG+  +E+V             +EQ
Sbjct  412  QLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQ 471
Query  315  QQKQKQEEE--PLEVQRYRAELSEDDVFVIPAAYP--FVVNATSNLNFLAFG-----INA 365
            QQ+Q+QEEE    + ++ R++LS  D+FV+PA +P  FV +   NL    FG     IN 
Sbjct  472  QQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINP 531
Query  366  ENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQ-RESYFVDAQPQQKEE 422
            ++NQR F+AG K N VRQ + Q +ELAF  S++ V+ ++    +ESYFV  Q Q+  E
Sbjct  532  DHNQRIFVAG-KINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQRQRASE 588

Sequence Alignment: 18. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 174.3 bits 737,  Expect = 1e-44
 Identities = 128/386 33%, Positives = 225/386 58%, Gaps = 20/386 5%
Query  28   EDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLP 87
            E E NP+ F S + F+    ++   IR L  F + S  LE +  YR+   + KPNT++LP
Sbjct  61   EREENPYVFHS-DRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLP 119
Query  88   HHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIK 147
            H+ DA ++L+V  GR  +  V  ++     L  GD   +P+G T+YLVN  DH +L+I  
Sbjct  120  HYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIAS 179
Query  148  LA-IPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
            L        G Y+ F+++  +  ++    FS ++LE +F+++ +++  + FG      ++
Sbjct  180  LLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FGA-----HR 233
Query  207  EGVIVELSKEQIRQLSRRAKSSSRKTISSED-EPFNLRSRNPIYSNNFGKFFEITPEKNP 265
             GVI   ++EQIR++ RR   S+  T +SE  +PFNLR++ P + N+ G+F    P+ NP
Sbjct  234  RGVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNP 293
Query  266  QLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQK-----QKQ 320
             L  +D+ +    +N G +  P  N+KA  I ++ EG+  IE+      Q+      +++
Sbjct  294  FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRER 353
Query  321  EEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSN--LNFLAFGINAENNQRNFLAGEKD 378
              + +  +R RA L    V+V+PA +P    A++N  L  L F IN   N+R FLAG K+
Sbjct  354  GHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KN 412
Query  379  NVVRQIERQVQELAF--PGSAQDVERLLKKQRESYFVDAQPQQKEE 422
            NV++ +E++V+ L+F  P   +++E +L+ Q++   +    +Q+ +
Sbjct  413  NVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQRRD 457

Sequence Alignment: 19. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 172.9 bits 731,  Expect = 4e-44
 Identities = 159/405 39%, Positives = 263/405 64%, Gaps = 23/405 5%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            ++  NNP+YF    SFQ  F  ++   R+LQRF  +   L  + ++RI  +++ PNT +L
Sbjct  176  QQQRNNPYYFHRR-SFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVL 234
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            PHH DA+ +  V +GR  +T+V +++++SYN+ PG   RIPAG+T YL N  + + L I 
Sbjct  235  PHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIA 294
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
             L  PVN PG++  FF +  +  QSYL+ FS  ILE  F++  E+++ +  G +  +RQQ
Sbjct  295  VLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQ 354
Query  207  -EGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEK-N 264
             +G+  + S+EQIR LS+ A S   K   SE   FNL S+ P YSN  G+F+E  P    
Sbjct  355  GQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQ 412
Query  265  PQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV--GIKEQ------QQ 316
             QLR++D  + + +IN+G++++PH+NSKA  ++++ EG+ ++E+V   +  Q      ++
Sbjct  413  QQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSRE 472
Query  317  KQKQEEEPLE-----VQRYRAELSEDDVFVIPAAYP--FVVNATSNLNFLAFGI-NAENN 368
            +++QEE+ +E      +R RA+LS  ++FV+PA +P  FV +   +L +L FG+ N ++N
Sbjct  473  EEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDN 532
Query  369  QRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQ-RESYFVDAQPQQKEEGSKGR 427
            +R F+AG K N VRQ +RQ +ELAF   ++ V+ ++    +ESYFV  + ++  +  +G 
Sbjct  533  KRIFVAG-KTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERRGS 591
Query  428  KGPFPSIL 435
              P+   L
Sbjct  592  NNPLSPFL 599

Sequence Alignment: 20. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 170.4 bits 720,  Expect = 2e-43
 Identities = 246/409 60%, Positives = 336/409 82%, Gaps = 22/409 5%
Query  30   ENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHH 89
            + NP++F SSN FQT + N+N +IR+L+RFN+R+ +LENL++YRI++FQSKPNT++LP H
Sbjct  182  QRNPYHF-SSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKH 240
Query  90   ADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLA 149
            +DADF+L VL+GRA +T+VN D R  YNL  GDA R+PAGTT Y++NP D+QNL++ KLA
Sbjct  241  SDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLA 300
Query  150  IPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFG-----EEEEQR 204
            IP+N PG+  DF+ S+T+ QQSY+ GFS N LE +F++ +EEI RVL+G     E E+QR
Sbjct  301  IPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQR 360
Query  205  -------QQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFF 257
                   Q EGVIV +SK+QI++L + A+SSS +   SE  PFNLRS  PIYSN FG F+
Sbjct  361  RGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLRSNKPIYSNKFGNFY 420
Query  258  EITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQK 317
            EITP+ NPQ++DL+I L+  +INEGALLLPH+NSKAI I+V++EG+ N ELVGI++QQ++
Sbjct  421  EITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQ 480
Query  318  QKQEEEPLE-----VQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNF 372
            Q ++EE  E     V+RY  +LS+ DVF+IPA +P+ +NA+SNL +L FGINA  NQRNF
Sbjct  481  QDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRLLGFGINANENQRNF 540
Query  373  LAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE----EGSKGRK 428
            LAG +DNV++Q++R+V+EL FPGS +DVERL+K Q++SYF +AQPQQ++    EG +GR+
Sbjct  541  LAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEGRRGRR 600
Query  429  GPFPSILGALY 439
            GP  SIL ALY
Sbjct  601  GPISSILNALY 611

Sequence Alignment: 21. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 164.5 bits 694,  Expect = 9e-42
 Identities = 245/393 62%, Positives = 333/393 84%, Gaps = 26/393 6%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R D+ NPF F+S N FQT++EN+N  IRLLQRF+KRS  +ENL++YR+++++SKP+TI+L
Sbjct  2    RSDQENPFIFKS-NRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P+  DADF+L VLSG+AILT++N++DR+S+NL  GD  ++PAGT  YL N  D+++L+++
Sbjct  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
             LAIPVN+PG+   F+LS TQ Q S+L GFS NILE +F++E+EEI +VL+ EE+EQ+ Q
Sbjct  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLL-EEQEQKSQ 179
Query  207  --------------EGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNN 252
                          E VIV++S+EQI +LS+ AKSSS+K++SSE EPFNLRSRNPIYSN 
Sbjct  180  HRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNK 239
Query  253  FGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIK 312
            FGKFFEITPEKNPQL+DLDIF++SV+I EG+LLLP++NS+AIVI+ +NEG  + ELVG +
Sbjct  240  FGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQR 299
Query  313  -EQQQKQK--------QEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFG 362
             E QQ+Q+        QEEE   +VQRYRA LS  DV+VIPA +P  +NA+S+LN++ FG
Sbjct  300  NENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFG 359
Query  363  INAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421
            INA+NNQRNFLAGE+DNV+ QI+R V+ELAFPGS+++V+RLL  Q++S+F +AQP Q E
Sbjct  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 22. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 160.0 bits 674,  Expect = 2e-40
 Identities = 238/394 60%, Positives = 329/394 83%, Gaps = 21/394 5%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R D+ NPF F+S N FQTL+EN+N  IRLLQ+F+KRS  +ENL++YR+++++SKP+T++L
Sbjct  2    RSDQENPFIFKS-NRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P++ DADF+L VLSG+A LT++ ++DR+S+NL  GDA ++PAGT  YL N  D+++L+++
Sbjct  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQ- 205
             LAIPVNKPG+   F+LS TQ Q S L GFS NILE +F++ +EEI +VL+ ++E++ Q 
Sbjct  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  206  ------------QEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNF 253
                        +E VIV++S+EQI +LS+ AKSSS+K++SSE  PFNLRSRNPIYSN F
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  254  GKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGI-- 311
            GKFFEITPEKN QL+DLDIF++SVDI EG+LLLP++NS+AIVI+ + EG  + ELVG   
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  312  ----KEQQQKQKQEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAE 366
                KE  ++++QEEE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN++ FGINAE
Sbjct  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
Query  367  NNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421
            NN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+++V+RLLK Q++SYF +AQP Q+E
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 23. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 159.3 bits 671,  Expect = 3e-40
 Identities = 233/394 59%, Positives = 334/394 84%, Gaps = 21/394 5%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R D+ NPF F+S N FQT++EN+N  IRLLQ+F+KRS  +ENL++YR+++++SKP+T++L
Sbjct  2    RSDQENPFIFKS-NRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P++ DADF+L VLSG+A+LT++N++DR+S+NL  GD  ++PAGT  YL N  D+++L+++
Sbjct  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQ- 205
             LAIPVN PG+ + F+LS TQ Q S+L GF+ +ILE +F++++EEI +VL+ ++E++ Q 
Sbjct  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
Query  206  ------------QEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNF 253
                        +E VIV++S+EQI++LS+ AKSSS+K++SSE EPFNLRSRNPIYSN F
Sbjct  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  254  GKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKE 313
            GKFFEITPEKNPQL+DLDIF++SV+I EG+LLLP++NS+AIVI+ +NEG    ELVG + 
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
Query  314  QQQKQK------QEEEP-LEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAE 366
            + Q+++      QEEE   +VQRYRA+LS  DVFV+PA +P  +NA+S+LN++ FGINA+
Sbjct  301  ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAK 360
Query  367  NNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421
            NNQRNFLAGE+DNV+ QI+R V+ELAFPGS+++V+RLL  Q++S+F +AQP Q E
Sbjct  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 24. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 157.4 bits 663,  Expect = 2e-39
 Identities = 124/389 31%, Positives = 226/389 58%, Gaps = 17/389 4%
Query  25   KVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTI 84
            +  E++ NP+ F   + F T  + +  ++ LL +F ++S  L  L  YR+  + + P   
Sbjct  144  EAEEEDENPYVFEDED-FTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAF 202
Query  85   LLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLK 144
            ++P H DAD ++FV  GR  +T +  + R+S N+  GD   I +GT +Y+ N  +++ L 
Sbjct  203  VVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLY 262
Query  145  IIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQR 204
            ++++  PVN PG ++ F     +  +S+ + FS  ILE ++ +  + + + LF     ++
Sbjct  263  LVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF-----EK 316
Query  205  QQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-PFNLRSRNPIYSNNFGKFFEITPEK 263
            Q +G I++ SKEQIR +SRR +       + E    F L  ++P  SN +G++FE     
Sbjct  317  QDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERID 376
Query  264  NPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEE 323
             P L  LD+ +S  +I +G + +P +NS+A  I ++  G+  +E+        K  +   
Sbjct  377  YPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH--- 433
Query  324  PLEVQRYRAELSEDDVFVIPAAYPF--VVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
            P   ++ RA + +D VF++PA +PF  V +   NL  + F +NAE N R  LAG+K N++
Sbjct  434  P-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NII 491
Query  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGR 427
            + +E++ +ELAF    ++V++++ KQ E +F    P+ ++E  +GR
Sbjct  492  KVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKE-KEGR 535

Sequence Alignment: 25. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 157.2 bits 662,  Expect = 2e-39
 Identities = 123/389 31%, Positives = 226/389 58%, Gaps = 17/389 4%
Query  25   KVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTI 84
            +  E++ NP+ F   + F T  + +  ++ LL +F ++S  L  L  YR+  + + P   
Sbjct  142  EAEEEDENPYVFEDED-FTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAF 200
Query  85   LLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLK 144
            ++P H DAD ++FV  GR  +T +  + R+S N+  GD   I +GT +Y+ N  +++ L 
Sbjct  201  VVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLY 260
Query  145  IIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQR 204
            ++++  PVN PG ++ F     +  +S+ + FS  ILE ++ +  + + + LF     ++
Sbjct  261  LVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF-----EK 314
Query  205  QQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-PFNLRSRNPIYSNNFGKFFEITPEK 263
            Q +G I++ SKEQ+R +SRR +       + E    F L  ++P  SN +G++FE     
Sbjct  315  QDQGTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERID 374
Query  264  NPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEE 323
             P L  LD+ +S  +I +G + +P +NS+A  I ++  G+  +E+        K  +   
Sbjct  375  YPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH--- 431
Query  324  PLEVQRYRAELSEDDVFVIPAAYPF--VVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
            P   ++ RA + +D VF++PA +PF  V +   NL  + F +NAE N R  LAG+K N++
Sbjct  432  P-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NII 489
Query  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGR 427
            + +E++ +ELAF    ++V++++ KQ E +F    P+ ++E  +GR
Sbjct  490  KVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKE-KEGR 533

Sequence Alignment: 26. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 156.1 bits 657,  Expect = 3e-39
 Identities = 236/394 59%, Positives = 325/394 82%, Gaps = 21/394 5%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            R D+ NPF F+S N FQTL+EN+N  IRLLQ+F+KRS  +ENL++YR+++++SKP T++L
Sbjct  2    RSDQENPFIFKS-NRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFL 60
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P+  DADF+L VLSG+A LT++ ++DR+S+NL  GD  ++PAGT  YL N  D+++L+++
Sbjct  61   PQCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQ- 205
             L IPVNKPG+   F+LS TQ Q S L GFS NILE +F++ +EEI +VL+ ++E++ Q 
Sbjct  121  DLTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  206  ------------QEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNF 253
                        +E VIV++S+EQI +LS+ AKSSS+K++SSE  PFNLRSRNPIYSN F
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  254  GKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGI-- 311
            GKFFEITPEKN QL+DLDIF++SVDI EG+LLLP++NS+AIVI+ + EG  + ELVG   
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  312  ----KEQQQKQKQEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAE 366
                KE  ++++QEEE   +VQ YRA+LS  DVFVIPA +P  +NA+S+LN++ FGINAE
Sbjct  301  ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAE 360
Query  367  NNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421
            NN+RNFLAGE+DNV+ Q+ER V+ELAFPGS+++V+RLLK Q++SYF +AQP Q+E
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 27. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 153.3 bits 645,  Expect = 3e-38
 Identities = 234/413 56%, Positives = 332/413 80%, Gaps = 44/413 10%
Query  25   KVRED--ENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPN 82
            +VRE+   NNPFYF  S  F T + NQN RIR+LQRF++RS Q++NL+++RIVQ +++PN
Sbjct  158  EVREETSRNNPFYF-PSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPN 216
Query  83   TILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQN 142
            T++LP HADAD +L +  G+A +T+ N ++R S+NL  G A RIP+G   Y++N HD+QN
Sbjct  217  TLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQN 276
Query  143  LKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLF----- 197
            L++ K+++PVN PG+++DFF +S++ Q SYLQGFS N LE +F++EF EI RVL+     
Sbjct  277  LRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAG 336
Query  198  GEEEEQRQQ---------EGVIVELSKEQIRQLSRRAKSSSRKTISSED--EPFNLRSRN 246
            GE+EE+ Q+         EGVIV++SKE++++L++ AKS S+K    ED   P NLR   
Sbjct  337  GEQEERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGE 396
Query  247  PIYSNNFGKFFEITPEK-NPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDAN 305
            P  SNNFG++FE+ P+K NPQL+DLD+ L+ V+I EGAL+LPHFNSKA+VI+V+N+G  N
Sbjct  397  PDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGN 456
Query  306  IELVGI-KEQQQKQKQEEE-------------PLEVQRYRAELSEDDVFVIPAAYPFVVN 351
            +ELV + KEQQQ+ ++E+E               EV+RY A L E DVF++PAA+P  +N
Sbjct  457  LELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAIN 516
Query  352  ATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESY 411
            A+S L++L FGINAENN+R FLAG+KDNV+ QIE+Q ++LAFPGS + VE+L+K QRES+
Sbjct  517  ASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESH 576
Query  412  FVDAQPQQK----------EEGSKGRKGPFPSILGAL 438
            FV A+PQ +          EE ++G KGP+ SIL A+
Sbjct  577  FVSARPQSQSPSSPEKEDQEEENQGGKGPLLSILKAF 613

Sequence Alignment: 28. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 153.3 bits 645,  Expect = 3e-38
 Identities = 237/410 57%, Positives = 332/410 80%, Gaps = 54/410 13%
Query  26   VRED--ENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNT 83
            VRE+   NNPFYF  S  F T + NQN RIR+LQRF++RS Q++NL+++RIVQ ++KPNT
Sbjct  165  VREETSRNNPFYF-PSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNT 223
Query  84   ILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNL 143
            ++LP HADAD +L +  G+A +T+ N ++R S+NL  G A RIP+G   Y++N HD+QNL
Sbjct  224  LVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNL 283
Query  144  KIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLF-----G 198
            ++ K+++PVN PG+++DFF +S++ Q SYLQGFS N LE +F++EF EI RVL+     G
Sbjct  284  RVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGG 343
Query  199  EEEEQRQQ----------EGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-----PFNLR 243
            E+EE+ Q+          EGVIV++SKE++ +L++ AKS S+K   SE+E     P NLR
Sbjct  344  EQEERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKK--GSEEEGDITNPINLR 401
Query  244  SRNPIYSNNFGKFFEITPEK-NPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEG 302
               P  SNNFGK+FE+ P+K NPQL+DLD+ L+ V+I EGAL+LPHFNSKA+VI+V+N+G
Sbjct  402  EGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKG 461
Query  303  DANIELVGI-KEQQQKQKQEEEP----------LEVQRYRAELSEDDVFVIPAAYPFVVN 351
              N+ELV + KEQQQ+ ++EEE            EV+RY A L E DVF++PAA+P  +N
Sbjct  462  TGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAIN 521
Query  352  ATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESY 411
            A+S L++L FGINAENN+R FLAG+KDNV+ QIE+Q ++LAFPGS + VE+L+K Q+ES+
Sbjct  522  ASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESH 581
Query  412  FVDAQPQQK-----------------EEGSKGRKGPFPSILGAL 438
            FV A+PQ +                 EE ++G KGP+ SIL A+
Sbjct  582  FVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPLLSILKAF 625

Sequence Alignment: 29. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 149.2 bits 627,  Expect = 4e-37
 Identities = 140/385 36%, Positives = 237/385 61%, Gaps = 19/385 4%
Query  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
            +E E NP+ F+  + F++  + +  R+++L+ F KRS  L  + ++R+  +++ P+T + 
Sbjct  55   KEQEENPYVFQDEH-FESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFIS 113
Query  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
            P H DA+++LFV  GRA +T+V  + R+S+N+  GD  RIPAGT  Y++N  +++ L I+
Sbjct  114  PAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIV 173
Query  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
            K+  PV+ PG ++ F+ +  +  +S+ + FS  +LE ++    E++ +V FGE     Q 
Sbjct  174  KILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKV-FGE-----QS 227
Query  207  EGVIVELSKEQIRQLSRRAKSSSRK-TISSEDE-PFNLRSRNPIYSNNFGKFFEITPEKN 264
            +G IV+ S+E+IR LS+  +   R      E   P NL  ++P  SN FG+++E  P+ +
Sbjct  228  KGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDH 287
Query  265  PQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEP 324
             QL+DLD+ +S  +I +G++  P++NS+A  I V+ EG+   E+                
Sbjct  288  KQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS----- 342
Query  325  LEVQRYRAELSEDDVFVIPAAYPFVVNAT--SNLNFLAFGINAENNQRNFLAGEKDNVVR 382
               Q+  A L    VFV PA +P  V A+  +NL  L F +NA  N R  LAG K N+V 
Sbjct  343  --YQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KGNIVN 399
Query  383  QIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKG 426
            + ER  +ELAF   +++VER++K Q +++F     +Q+EEG +G
Sbjct  400  EFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRG 443

Sequence Alignment: 30. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 58.3 bits 228,  Expect = 1e-09
 Identities = 108/409 26%, Positives = 204/409 49%, Gaps = 68/409 16%
Query  8    LLVLLGTVFLASVCVSLKVREDEN----NP-FYFRSSNSFQTLFENQNVRIRLLQRFNKR 62
            LL+LL  +       ++   +DE     +P   F  SNS + +F+     +R+L+    R
Sbjct  4    LLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMSNSTR-VFKTDAGEMRVLKSHGGR 62
Query  63   SPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGD 122
                   R   I     +P ++++P++ D+++++F+  G A L ++ +D+     L  GD
Sbjct  63   IFY----RHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGD 118
Query  123  AQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPG--RYDDFFLSSTQAQQSYLQGFSHNI 180
               IP+G+ +YLVN  + Q L +I    P    G   +  F++      +S L GF   I
Sbjct  119  LYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAI 178
Query  181  LETSFH---SEFEEI------NRVLFGEEEEQRQQEGVIVELSKE----QIRQL------ 221
            LET+F+   +  EEI        ++F ++          ++L K+    Q++++      
Sbjct  179  LETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEE 238
Query  222  SRRAKSSSR--------------KTISSEDE---P--FNLRS-RNPIYSNNFGKFFEITP 261
                K +SR              + I ++D    P  +NL   +   + N +G    +  
Sbjct  239  DEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHG 298
Query  262  EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQE 321
             + P L + DI +  V ++ G++L PH N  +    ++  G   +  +G           
Sbjct  299  GEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGELH-IGY---------- 347
Query  322  EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSN--LNFLAFGINAENNQRNFLAGEKDN 379
              P   +  + ++ + DVFV+P  +PF   A+ +  L F+ F  +A  N+  FLAG   +
Sbjct  348  --PNGSRAMKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAA-S 404
Query  380  VVRQIERQVQELAFPGSAQDVERLLKKQRESYFV-DAQPQQKEEGSKGRKGPFPSIL 435
            ++R +       AF  S   + R +  Q E+  +  A     E   K +    P+ +
Sbjct  405  LLRTLMGPELSAAFGVSEDTLRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAI 461

Sequence Alignment: 31. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 48.5 bits 185,  Expect = 9e-07
 Identities = 108/373 28%, Positives = 182/373 48%, Gaps = 69/373 18%
Query  34   FYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADAD 93
            F +R S   + +++     +RL+  +  R     N     I     +PNT+ +P++ DA 
Sbjct  56   FILRRS---KEVLKTDAGEVRLMMGYRYRG----NHSPMHIGFITMEPNTLYIPQYIDAS 108
Query  94   FLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII---KLAI 150
            ++LFV  G A +  +  +      L  G    IPAG+++Y+VN    + L II       
Sbjct  109  LILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLE 168
Query  151  PVNKPGRY-DDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLF-----------G 198
             +   G Y   F++      +S L GF  + L  +F+   +++  +L            G
Sbjct  169  SMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNG 228
Query  199  EEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-------------------- 238
            E  EQR     I++L KE++ Q          +    ED+                    
Sbjct  229  EAAEQRDYLSSIMQL-KERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQ 287
Query  239  --------P--FNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPH 288
                    P  +NL    P Y N++G    I       L+  ++ +  V++  GA+L PH
Sbjct  288  RKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPH 347
Query  289  FNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPF 348
             N  A    +I  G   I++V              P       A++SE DVF IP  +PF
Sbjct  348  VNPTATEYGIILRGSGTIQVV-------------FPNGTAAMNAKVSEGDVFWIPRYFPF 394
Query  349  VVNATSN--LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKK 406
               A+    L F+ F  +A  N+  FL G K +++  +       AF  S + +ER++K 
Sbjct  395  CQIASDGAPLEFFGFTTSARKNRPQFLVG-KSSLLHSMRGPELAAAFGVSEEQLERIVKA 453
Query  407  QRESYFVDAQPQQKEEGSKGRK 428
            QRE+  +   P+++ E   G+K
Sbjct  454  QREAVILPTSPHREMEEINGKK 475

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.