The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH
MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI
LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD56719 Ara h 7 160 1120 132.2 6.9e-33
Q9SQH1 Ara h 7.0101 160 1120 132.2 6.9e-33
B4XID4 Ara h 7.0201 164 834 101.6 1.1e-23
AAK96887 Ara h 2.0101 156 360 50.9 2e-08
ACN62248 Ara h 2.0101 157 347 49.5 5.2e-08
AAN77576 Ara h 2.0201 172 249 39.1 7.9e-05
AAD56337 Ara h 6 129 184 31.9 0.0082
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 7 Sequence ID: AAD56719

 Score = 132.2 bits 1120,  Expect = 7e-33
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH 60
            MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH
Sbjct  1    MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH 60
Query  61   MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI 120
            MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI
Sbjct  61   MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI 120
Query  121  LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL 160
            LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL
Sbjct  121  LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL 160

Sequence Alignment: 2. Allergen Name: Ara h 7.0101 Sequence ID: Q9SQH1

 Score = 132.2 bits 1120,  Expect = 7e-33
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH 60
            MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH
Sbjct  1    MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH 60
Query  61   MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI 120
            MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI
Sbjct  61   MRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQI 120
Query  121  LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL 160
            LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL
Sbjct  121  LQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL 160

Sequence Alignment: 3. Allergen Name: Ara h 7.0201 Sequence ID: B4XID4

 Score = 101.6 bits 834,  Expect = 1e-23
 Identities = 117/125 93%, Positives = 124/125 99%, Gaps = 0/125 0%
Query  2    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHM 61
            MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEH+
Sbjct  1    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHI 60
Query  62   RRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQIL 121
            R+RVE+EQEQEQDEYPY +RGSRG++PGESDE+QEQRCCNELNRFQNNQRCMCQALQQIL
Sbjct  61   RQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQIL 120
Query  122  QNQSF 126
            QNQSF
Sbjct  121  QNQSF 125

Sequence Alignment: 4. Allergen Name: Ara h 2.0101 Sequence ID: AAK96887

 Score = 50.9 bits 360,  Expect = 2e-08
 Identities = 62/111 55%, Positives = 89/111 80%, Gaps = 19/111 17%
Query  2    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHM 61
            M KL+ILVAL  AL+++A+         S   +W+   +GD +CQ QL+RANLRPCE+H+
Sbjct  1    MAKLTILVAL--ALFLLAA-------HASARQQWEL--QGDRRCQSQLERANLRPCEQHL 49
Query  62   RRRVEQEQEQ-EQDEY-----PYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQ 115
             ++++++++  E+D Y     PYS      R  G S ++QE RCCNELN F+NNQRCMC+
Sbjct  50   MQKIQRDEDSYERDPYSPSQDPYSPSPYDRRGAG-SSQHQE-RCCNELNEFENNQRCMCE 107
Query  116  ALQQILQNQS 125
            ALQQI++NQS
Sbjct  108  ALQQIMENQS 117

Sequence Alignment: 5. Allergen Name: Ara h 2.0101 Sequence ID: ACN62248

 Score = 49.5 bits 347,  Expect = 5e-08
 Identities = 60/108 55%, Positives = 87/108 80%, Gaps = 19/108 17%
Query  5    LSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHMRRR 64
            L+ILVAL  AL+++A+         S   +W+   +GD +CQ QL+RANLRPCE+H+ ++
Sbjct  1    LTILVAL--ALFLLAA-------HASARQQWEL--QGDRRCQSQLERANLRPCEQHLMQK 49
Query  65   VEQEQEQ-EQDEY-----PYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQ 118
            ++++++  E+D Y     PYS      R  G S ++QE RCCNELN F+NNQRCMC+ALQ
Sbjct  50   IQRDEDSYERDPYSPSQDPYSPSPYDRRGAG-SSQHQE-RCCNELNEFENNQRCMCEALQ 107
Query  119  QILQNQS 125
            QI++NQS
Sbjct  108  QIMENQS 114

Sequence Alignment: 6. Allergen Name: Ara h 2.0201 Sequence ID: AAN77576

 Score = 39.1 bits 249,  Expect = 8e-05
 Identities = 60/113 53%, Positives = 88/113 77%, Gaps = 27/113 23%
Query  2    MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHM 61
            M KL+ILVAL  AL+++A+         S   +W+   +GD +CQ QL+RANLRPCE+H+
Sbjct  1    MAKLTILVAL--ALFLLAA-------HASARQQWEL--QGDRRCQSQLERANLRPCEQHL 49
Query  62   RRRVEQEQEQE-QDEY-----PYS------RRGSRGRQP----GESDENQEQRCCNELNR 105
             ++++++++   +D Y     PYS      RR      P    G     +++RCCNELN 
Sbjct  50   MQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNE 109
Query  106  FQNNQRCMCQALQQILQNQS 125
            F+NNQRCMC+ALQQI++NQS
Sbjct  110  FENNQRCMCEALQQIMENQS 129

Sequence Alignment: 7. Allergen Name: Ara h 6 Sequence ID: AAD56337

 Score = 31.9 bits 184,  Expect = 0.008
 Identities = 45/81 55%, Positives = 62/81 76%, Gaps = 17/81 20%
Query  28   RGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHMRRRVEQEQEQEQDEYPY-SRRGSRGR 86
            R  RG + D+ S     C+RQ+   NL+PCE+H+ +R+  EQEQ  D Y + S R S   
Sbjct  7    RRERGRQGDSSS-----CERQVDGVNLKPCEQHIMQRIMGEQEQ-YDSYNFGSTRSS--- 57
Query  87   QPGESDENQEQRCCNELNRFQNNQRCMCQALQQILQNQ 124
                   +Q+QRCC+ELN  +N QRCMC+ALQQI++NQ
Sbjct  58   -------DQQQRCCDELNEMENTQRCMCEALQQIMENQ 88

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.