The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA
NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN
VVVTVKVLGDNGVLACAIATHAKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
CAK22338 Der p 2.0114 146 986 232.3 4e-63
P49278 Der p 2 146 957 225.7 4e-61
Q00855 Der f 2 146 886 209.5 3.1e-56
Q9TZZ2 Eur m 2 145 875 206.9 1.7e-55
ABA39437 Der p 2.0109 129 867 205.1 5.5e-55
CAQ68249 Der p 2.0115 129 865 204.7 7.5e-55
BAA01239 Der f 2 138 849 201.0 1e-53
BAA01241 Der f 2 138 843 199.6 2.6e-53
AAC82350 Eur m 2.0102 135 812 192.5 3.5e-51
ABA39438 Der f 2.0109 129 791 187.7 9.3e-50
AAK30133 Der f 2 170 745 177.2 1.8e-46
BAX34757 Der f 35.0101 143 424 103.8 1.9e-24
A6XEN8 Blo t 2.0104 142 423 103.6 2.2e-24
A6XEN9 Blo t 2.0104 142 423 103.6 2.2e-24
A6XEP2 Blo t 2.0104 142 416 102.0 6.7e-24
A6XEP1 Blo t 2.0104 142 416 102.0 6.7e-24
A6XEP6 Blo t 2.0104 142 416 102.0 6.7e-24
A6XEP3 Blo t 2.0104 142 415 101.8 7.9e-24
A6XEP4 Blo t 2.0104 142 409 100.4 2e-23
A6XEP5 Blo t 2.0104 142 407 99.9 2.8e-23
A6XEP0 Blo t 2.0104 142 406 99.7 3.3e-23
AAQ73482 Blo t 2.0102 142 402 98.8 6.2e-23
O02380 Tyr p 2 141 399 98.1 9.9e-23
AAQ73483 Blo t 2.0101 144 394 97.0 2.2e-22
P80384 Lep d 2 141 390 96.0 4.1e-22
CAD32313 Lep d 2.0102 141 385 94.9 9.1e-22
CAD32314 Lep d 2.0202 141 384 94.7 1.1e-21
CAA58755 Lep d 2.0201 141 379 93.5 2.4e-21
CAB76459 Gly d 2.0201 125 374 92.4 4.6e-21
AAQ73481 Blo t 2.0103 141 365 90.3 2.2e-20
CAB59976 Gly d 2.0101 128 332 82.8 3.6e-18
CAA57160 Lep d 2.0101 98 285 72.1 4.7e-15
ABG76195 Der f 22.0101 155 272 69.0 6e-14
Q28895 Can f 7.0101 149 169 45.5 7.1e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 232.3 bits 986,  Expect = 4e-63
 Identities = 146/146 100%, Positives = 146/146 100%, Gaps = 0/146 0%
Query  1    MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA 60
            MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA
Sbjct  1    MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA 60
Query  61   NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN
Sbjct  61   NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
Query  121  VVVTVKVLGDNGVLACAIATHAKIRD 146
            VVVTVKVLGDNGVLACAIATHAKIRD
Sbjct  121  VVVTVKVLGDNGVLACAIATHAKIRD 146

Sequence Alignment: 2. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 225.7 bits 957,  Expect = 4e-61
 Identities = 140/146 95%, Positives = 144/146 98%, Gaps = 0/146 0%
Query  1    MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA 60
            MMYKILCLSLLVAAVA DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEA+FEA
Sbjct  1    MMYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEA 60
Query  61   NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQNTK AKIEIKASIDGLEVDVPGIDPNACHY+KCPLVKGQQYDIKYTWNVPKIAPKSEN
Sbjct  61   NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
Query  121  VVVTVKVLGDNGVLACAIATHAKIRD 146
            VVVTVKV+GD+GVLACAIATHAKIRD
Sbjct  121  VVVTVKVMGDDGVLACAIATHAKIRD 146

Sequence Alignment: 3. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 209.5 bits 886,  Expect = 3e-56
 Identities = 128/146 87%, Positives = 139/146 95%, Gaps = 0/146 0%
Query  1    MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA 60
            M+ KILCLSLLVAAV ADQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEALF+A
Sbjct  1    MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA 60
Query  61   NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQNTK AKIEIKAS+DGLE+DVPGID NACH++KCPLVKGQQYDIKYTWNVPKIAPKSEN
Sbjct  61   NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
Query  121  VVVTVKVLGDNGVLACAIATHAKIRD 146
            VVVTVK++GDNGVLACAIATH KIRD
Sbjct  121  VVVTVKLIGDNGVLACAIATHGKIRD 146

Sequence Alignment: 4. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 206.9 bits 875,  Expect = 2e-55
 Identities = 124/145 85%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            MYKILCLSLLVAAVAADQVD+KDCANHEIKKV+VPGC GSEPC+IHRG  FQLEA+F+AN
Sbjct  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            QN+  AKIEIKA+IDG+E+DVPGID N CH++KCPLVKGQ+YDIKYTWNVP+IAPKSENV
Sbjct  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
Query  122  VVTVKVLGDNGVLACAIATHAKIRD 146
            VVTVK+LGDNGVLACAIATHAKIRD
Sbjct  121  VVTVKLLGDNGVLACAIATHAKIRD 145

Sequence Alignment: 5. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 205.1 bits 867,  Expect = 5e-55
 Identities = 125/129 96%, Positives = 128/129 99%, Gaps = 0/129 0%
Query  18   DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG 77
            DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEA+FEANQN+K AKIEIKASIDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  78   LEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 137
            LEVDVPGIDPNACHY+KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
Query  138  IATHAKIRD 146
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 6. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 204.7 bits 865,  Expect = 8e-55
 Identities = 124/129 96%, Positives = 128/129 99%, Gaps = 0/129 0%
Query  18   DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG 77
            DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEA+FEANQN+K AKIEIKASIDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  78   LEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 137
            LEVDVPGIDPNACHY+KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKV+GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACA 120
Query  138  IATHAKIRD 146
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 7. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 201.0 bits 849,  Expect = 1e-53
 Identities = 123/138 89%, Positives = 132/138 95%, Gaps = 0/138 0%
Query  9    SLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAK 68
            SLLVAAV ADQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEALF+ANQNTK AK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  69   IEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVL 128
            IEIKAS+DGLE+DVPGID NACH+VKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 120
Query  129  GDNGVLACAIATHAKIRD 146
            GDNGVLACAIATH KIRD
Sbjct  121  GDNGVLACAIATHGKIRD 138

Sequence Alignment: 8. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 199.6 bits 843,  Expect = 3e-53
 Identities = 122/138 88%, Positives = 132/138 95%, Gaps = 0/138 0%
Query  9    SLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAK 68
            SLLVAAV ADQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEALF+ANQNTK AK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  69   IEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVL 128
            IEIKAS+DGLE+DVPGID NACH++KCPLVKGQQYD KYTWNVPKIAPKSENVVVTVK++
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
Query  129  GDNGVLACAIATHAKIRD 146
            GDNGVLACAIATHAKIRD
Sbjct  121  GDNGVLACAIATHAKIRD 138

Sequence Alignment: 9. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 192.5 bits 812,  Expect = 4e-51
 Identities = 115/135 85%, Positives = 128/135 94%, Gaps = 0/135 0%
Query  12   VAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEI 71
            VAAVAADQVDVKDCANHEIKKV+VPGC GSEPC+IHRG  FQLEA+F+ANQN+  AKIEI
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  72   KASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDN 131
            KA+IDG+E+DVPGID N CH++KCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK+LGDN
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  132  GVLACAIATHAKIRD 146
            GVLACAIATHAKIRD
Sbjct  121  GVLACAIATHAKIRD 135

Sequence Alignment: 10. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 187.7 bits 791,  Expect = 9e-50
 Identities = 115/129 89%, Positives = 124/129 96%, Gaps = 0/129 0%
Query  18   DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG 77
            DQVDVKDCAN+EIKKV+V G HGS+PCIIHRGKPF LEALF+ANQNTK AKIEIKA+I+G
Sbjct  1    DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING 60
Query  78   LEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 137
            LEVDVPGID NACH+VKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 120
Query  138  IATHAKIRD 146
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 11. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 177.2 bits 745,  Expect = 2e-46
 Identities = 125/141 88%, Positives = 135/141 95%, Gaps = 29/141 20%
Query  6    LCLSLLVAAVAADQVDVKDC-----------------------------ANHEIKKVLVP 36
            LCLSLLVAAV ADQVDVKDC                             AN+EIKKV+V 
Sbjct  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
Query  37   GCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCP 96
            GCHGS+PCIIHRGKPF LEALF+ANQNTK AKIEIKAS+DGLE+DVPGID NACH++KCP
Sbjct  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
Query  97   LVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKIRD 146
            LVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACAIATH KIRD
Sbjct  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170

Sequence Alignment: 12. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 103.8 bits 424,  Expect = 2e-24
 Identities = 60/142 42%, Positives = 97/142 68%, Gaps = 4/142 2%
Query  2    MYKILCLSLLVAAVA-ADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA 60
            M K LC+  L  AVA A ++   DC + E+  + V GC G + C++H+GK   L+   ++
Sbjct  1    MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMKCKS 59
Query  61   NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQ++++ K+ I A ++G+E++VPG D + CHYV+CP+ KGQ YDIKY++NVP + P  + 
Sbjct  60   NQDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKG 119
Query  121  VVVTVKVLGDNGVLACAIATHAKIRD 146
             + T KV+GDNG++ C +  + +I D
Sbjct  120  TL-TAKVIGDNGLVGC-LKLNGEIAD 143

Sequence Alignment: 13. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 103.6 bits 423,  Expect = 2e-24
 Identities = 58/133 43%, Positives = 91/133 68%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C IH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CTIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A+++G+EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 103.6 bits 423,  Expect = 2e-24
 Identities = 57/133 42%, Positives = 91/133 68%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C IH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CTIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A+++G+EV VPG+D + C +  CPL KGQ+Y++ Y+  +P + P  + V
Sbjct  60   QDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 102.0 bits 416,  Expect = 7e-24
 Identities = 58/133 43%, Positives = 90/133 67%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 102.0 bits 416,  Expect = 7e-24
 Identities = 58/133 43%, Positives = 90/133 67%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 102.0 bits 416,  Expect = 7e-24
 Identities = 58/133 43%, Positives = 90/133 67%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 18. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 101.8 bits 415,  Expect = 8e-24
 Identities = 57/133 42%, Positives = 90/133 67%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + +
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTI 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 19. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 100.4 bits 409,  Expect = 2e-23
 Identities = 57/133 42%, Positives = 90/133 67%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC   + CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGC-SDDHCIIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 20. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 99.9 bits 407,  Expect = 3e-23
 Identities = 55/133 41%, Positives = 89/133 66%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+   A  V   DCA+ E+  + +  C G   C IH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDH-CTIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A+++G+EV VPG+D + C +  CPL KGQ+Y++ Y+  +P + P  + V
Sbjct  60   QDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 21. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 99.7 bits 406,  Expect = 3e-23
 Identities = 57/133 42%, Positives = 89/133 66%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   CII +GK F L+ +F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 22. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 98.8 bits 402,  Expect = 6e-23
 Identities = 56/133 42%, Positives = 88/133 66%, Gaps = 2/133 1%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV+  A   V    CA+ E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 23. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 98.1 bits 399,  Expect = 1e-22
 Identities = 63/136 46%, Positives = 88/136 64%, Gaps = 7/136 5%
Query  4    KILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQN 63
            K L L  LVA  AA QV   DC   EI  V V GC G + C+IH+ KP ++ A F ANQ+
Sbjct  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
Query  64   TKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            T   ++++   ++GLEV +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
Query  124  TVKVL--GDNGVLAC-AIATHAK 143
             VK+L  G++GVLAC A+ T  K
Sbjct  118  VVKLLATGEHGVLACGAVNTDVK 140

Sequence Alignment: 24. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 97.0 bits 394,  Expect = 2e-22
 Identities = 57/133 42%, Positives = 89/133 66%, Gaps = 4/133 3%
Query  2    MYKILCLSLLV--AAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFE 59
            M+K +CL+LL   +  AA  V   DCA+ E+  + + GC G   CIIH+GK F L+ +F 
Sbjct  1    MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFI 59
Query  60   ANQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSE 119
            ANQ+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  +
Sbjct  60   ANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLK 119
Query  120  NVVVTVKVLGDNGVLAC 136
             V  T  ++GD+GV+AC
Sbjct  120  TVT-TASLVGDHGVVAC 135

Sequence Alignment: 25. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 96.0 bits 390,  Expect = 4e-22
 Identities = 54/140 38%, Positives = 88/140 62%, Gaps = 3/140 2%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+T    I++ A + G  + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +  
Sbjct  60   QDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
Query  122  VVTVKVLGDNGVLACAIATHAKI 144
             VT +++GD+GV+AC    H ++
Sbjct  119  DVTAELIGDHGVMACG-TVHGQV 140

Sequence Alignment: 26. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 94.9 bits 385,  Expect = 9e-22
 Identities = 53/140 37%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + C+IHRG+   LEA F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+T    I++   + G  + VPG++ + C ++KCP+ KG+  D  Y+  +P I PK +  
Sbjct  60   QDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
Query  122  VVTVKVLGDNGVLACAIATHAKI 144
             VT +++GD+GV+AC    H ++
Sbjct  119  DVTAELIGDHGVMACG-TVHGQV 140

Sequence Alignment: 27. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 94.7 bits 384,  Expect = 1e-21
 Identities = 54/140 38%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+T    I++ A + G  + VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V
Sbjct  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-V 118
Query  122  VVTVKVLGDNGVLACAIATHAKI 144
             VT +++GD+GV+AC    H ++
Sbjct  119  DVTAELVGDHGVMACG-TIHGQV 140

Sequence Alignment: 28. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 93.5 bits 379,  Expect = 2e-21
 Identities = 53/140 37%, Positives = 86/140 61%, Gaps = 3/140 2%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + C+IHRG+   L+A F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+T    I++ A + G  + VPG++ + C  +KCP+ KG+  D  Y   +P I PK +  
Sbjct  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-A 118
Query  122  VVTVKVLGDNGVLACAIATHAKI 144
             VT +++GD+GV+AC    H ++
Sbjct  119  DVTAELVGDHGVMACG-TIHGQV 140

Sequence Alignment: 29. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 92.4 bits 374,  Expect = 5e-21
 Identities = 53/116 45%, Positives = 77/116 66%, Gaps = 2/116 1%
Query  19   QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDGL 78
            ++  KDC   E+ ++ +  C G + C+IHRGKP+ LEA F ANQ+T  A I++ A + G 
Sbjct  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  79   EVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 136
             + VPG++ + C +VKCP+ KG   D KYT  VP I PK +   VT +++GD+GVLAC
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 30. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 90.3 bits 365,  Expect = 2e-20
 Identities = 53/132 40%, Positives = 86/132 65%, Gaps = 3/132 2%
Query  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
            M+K +CL+LLV++        + C   E+  + + GC G   CIIH+GK F L+ +F AN
Sbjct  1    MFKFICLALLVSSRRQRCQIYRSCT-WEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 58
Query  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +EV VPG+D + C +  CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  59   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 118
Query  122  VVTVKVLGDNGVLAC 136
              T  ++GD+GV+AC
Sbjct  119  T-TASLVGDHGVVAC 132

Sequence Alignment: 31. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 82.8 bits 332,  Expect = 4e-18
 Identities = 47/116 40%, Positives = 82/116 70%, Gaps = 4/116 3%
Query  19   QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG- 77
            +++  DC ++EIK++ V  C G+  C+IHRGKP+ L+A F+ANQ+T +  + + A IDG 
Sbjct  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  78   LEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKVLGDNGVLAC 136
            + +D+PG++ NAC  +KCP+ KG++ ++ Y    +P   P+ +   V  +++G++GVLAC
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 72.1 bits 285,  Expect = 5e-15
 Identities = 39/97 40%, Positives = 62/97 63%, Gaps = 2/97 2%
Query  46   IHRGKPFQLEALFEANQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDI 105
            IHRG+   LEA F ANQ+T    I++ A + G  + VPG++ + C ++KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  106  KYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKI 144
             Y+  +P I PK +   VT +++GD+GV+AC    H ++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 69.0 bits 272,  Expect = 6e-14
 Identities = 57/132 43%, Positives = 85/132 64%, Gaps = 13/132 9%
Query  3    YKILCLSL--LVAAVAADQVDV--KDCANHEIKKVLVPGCHGSEP-CIIHRGKPFQLEAL 57
            + I+C++L  L AAV AD+ +V  KDC ++EIK  +V G + ++  C+IH+    QL   
Sbjct  4    FLIVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRIS 63
Query  58   FEANQNTKNAKIEIK--ASIDGLEVDVPGID-PNAC--HYVKCPLVKGQQYDIKYTWNVP 112
            F AN+NT N KI  +   ++ G+E+  PGID  +AC  H + CPL KGQ Y+    +N+ 
Sbjct  64   FVANENTGN-KINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLG 122
Query  113  KIAPKSENVVVTVKVL-GDNGVLAC 136
               P + NV  TV++  G  G L C
Sbjct  123  DDVP-TANVTATVRLENGHGGDLLC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 45.5 bits 169,  Expect = 7e-07
 Identities = 34/109 31%, Positives = 59/109 54%, Gaps = 7/109 6%
Query  20   VDVKDC--ANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDG 77
            V  KDC  A   IK++ V  C  ++PC +H+G+ + +   F +N  ++++K  +   + G
Sbjct  22   VHFKDCGSAVGVIKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLG 80
Query  78   LEVDVPGIDPNACHY-VKCPLVKGQQYDIKYTWNVP-KIAPKSENVVVTVKVLGDN 131
            + V  P  + + C   + CP+ K + Y   Y   +P K    S  +VV   +LGDN
Sbjct  81   VAVPFPIPEADGCKSGINCPIQKDKTYS--YLNKLPVKNEYPSIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.