The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MNCGKIILLFITIIGVAKSREENCKCGWDNPSRIVNGVETEINEFPMVARLIYPSPGMYC
GGTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNY
NSHNNDIAIVKTNERFEYSMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLR
KVDLHVITREQCETHYGAAIANANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVV
NFGRTCADDAPGGNARVTSFMEFIHNATIGETYCKAD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAP37412 Pol d 4.0101 277 1890 437.4 2.6e-124
AAN02286 Api m 7 405 776 183.4 1.1e-47
3989146 Pol e 4.0101 241 497 119.9 8.5e-29
Q7M4I3 Bom p 4.0101 243 396 96.9 7.3e-22
P49275 Der f 3 259 353 87.1 7.1e-19
P39675 Der p 3 261 341 84.4 4.8e-18
O97370 Eur m 3 261 332 82.3 2e-17
AAM10779 Blo t 3.0101 266 323 80.2 8.4e-17
ABZ81991 Tyr p 3.0101 285 294 73.6 9e-15
AAQ24544 Blo t 6.0101 275 232 59.5 1.5e-10
AAP57077 Der p 9.0101 273 214 55.4 2.6e-09
P49276 Der f 6 279 213 55.1 3.2e-09
AAN02511 Der p 9.0102 261 212 54.9 3.4e-09
P09582 Can f 5.0101 260 203 52.9 1.4e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol d 4.0101 Sequence ID: AAP37412

 Score = 437.4 bits 1890,  Expect = 3e-124
 Identities = 277/277 100%, Positives = 277/277 100%, Gaps = 0/277 0%
Query  1    MNCGKIILLFITIIGVAKSREENCKCGWDNPSRIVNGVETEINEFPMVARLIYPSPGMYC 60
            MNCGKIILLFITIIGVAKSREENCKCGWDNPSRIVNGVETEINEFPMVARLIYPSPGMYC
Sbjct  1    MNCGKIILLFITIIGVAKSREENCKCGWDNPSRIVNGVETEINEFPMVARLIYPSPGMYC 60
Query  61   GGTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNY 120
            GGTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNY
Sbjct  61   GGTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNY 120
Query  121  NSHNNDIAIVKTNERFEYSMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLR 180
            NSHNNDIAIVKTNERFEYSMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLR
Sbjct  121  NSHNNDIAIVKTNERFEYSMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLR 180
Query  181  KVDLHVITREQCETHYGAAIANANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVV 240
            KVDLHVITREQCETHYGAAIANANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVV
Sbjct  181  KVDLHVITREQCETHYGAAIANANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVV 240
Query  241  NFGRTCADDAPGGNARVTSFMEFIHNATIGETYCKAD 277
            NFGRTCADDAPGGNARVTSFMEFIHNATIGETYCKAD
Sbjct  241  NFGRTCADDAPGGNARVTSFMEFIHNATIGETYCKAD 277

Sequence Alignment: 2. Allergen Name: Api m 7 Sequence ID: AAN02286

 Score = 183.4 bits 776,  Expect = 1e-47
 Identities = 112/246 45%, Positives = 166/246 67%, Gaps = 13/246 5%
Query  23   NCKCGWDNPSRIVNGVETEINEFPMVARLIYP-SPGMYCGGTIITPQHIVTAAHCLQKYK 81
            NC CGW NPSRIV G  T INEFPM+A +     PGM CG TII+ ++++TAAHC+    
Sbjct  150  NCNCGWKNPSRIVGGTNTGINEFPMMAGIKRTYEPGMICGATIISKRYVLTAAHCIID-- 207
Query  82   RTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNS------HNNDIAIVKTNER 135
              N T + +VVGEHD+++ TETN T  ++I +V IHP Y+       + NDIA++KT + 
Sbjct  208  -ENTTKLAIVVGEHDWSSKTETNATVLHSINKVIIHPKYDIIEKDDWQINDIALLKTEKD 266
Query  136  FEYSMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLRKVDLHVITREQCETH 195
             ++  KVGP CLPF +   ++    VT LGWG   +NG  S +L+K  L+++T+ +C  +
Sbjct  267  IKFGDKVGPACLPFQHFLDSFAGSDVTVLGWGHTSFNGMLSHILQKTTLNMLTQVECYKY 326
Query  196  YGAAIANANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVVNFGRTCADDAPGGNA 255
            YG  + NA  +C +  G+DACQ DSGGP+LW++P T  L+ +G++++G  C    P GN 
Sbjct  327  YGNIMVNA--MCAYAKGKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECGK-YPNGNT 383
Query  256  RVTSFMEFIHNATIGETYC 274
            +V S++++I + T    YC
Sbjct  384  KVGSYIDWIVSQTPDAEYC 402

Sequence Alignment: 3. Allergen Name: Pol e 4.0101 Sequence ID: 3989146

 Score = 119.9 bits 497,  Expect = 8e-29
 Identities = 98/234 41%, Positives = 125/234 53%, Gaps = 16/234 6%
Query  34   IVNGVETEINEFPMVARLIYPSPGMYCGGTIITP--QHIVTAAHCLQKYKRTNYTGIHVV 91
            +VNGVET INEFPM+ARLIY     YCGGTIITP  +HI+TAAHC++ +           
Sbjct  1    LVNGVETGINEFPMMARLIYXXXXFYCGGTIITPPFKHILTAAHCVEGFLDPTLXXXXST 60
Query  92   VGEHDYTTDTETNVTKRYTIAEVTIHPNYNSHNNDIAIVKTNERFEYSMKVGPVCLPFNY 151
             GE   T D    ++  YTI +VTIHPNY  H+NDI+IV           VGPVCLPFNY
Sbjct  61   TGE---TYD----LSXXYTI-KVTIHPNYFDHDNDISIVLXXXXXXXXXXVGPVCLPFNY 112
Query  152  MTRNLTNETVTALGWGKLRYNGQNSKVLRKVDLHVITRE-QCETH-YGAAIANANLLCTF 209
            M R +T+ TVTALGWGK                 +I  +  C+       +        +
Sbjct  113  MNRVFTDVTVTALGWGKXXXXXXXXXXXXXXXXLIIYFDIGCQDDPLSLVLIXXXXXXXY 172
Query  210  DVG---RDACQNDSGGPILWRSPTTDNLILVGVVNFGRTCADDAPGGNARVTSFMEFIHN 266
             +    +                               TC+D  PGGN RVTS+MEFI +
Sbjct  173  GISNNPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCSDCWPGGNMRVTSYMEFIXS 232
Query  267  ATIGETYCKA 276
             T+GETYC++
Sbjct  233  -TVGETYCES 241

Sequence Alignment: 4. Allergen Name: Bom p 4.0101 Sequence ID: Q7M4I3

 Score = 96.9 bits 396,  Expect = 7e-22
 Identities = 78/223 34%, Positives = 124/223 55%, Gaps = 22/223 9%
Query  34   IVNGVETEINEFP-MVA------RLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTNYT 86
            +V G   ++  +P MVA      R    SP   CGG++   +H++TAAHC     R+ Y 
Sbjct  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHC--AIHRSLYV 58
Query  87   GIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNY--NSHNNDIAIVKTNERFEYSMKVGP 144
               V + + +   D +     +  I    IHP+Y  + H++DIAI+K  +   +S  + P
Sbjct  59   ---VRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRP 115
Query  145  VCLPFNYMTRN--LTNETVTALGWGKLRYNGQNSKVLRKVDLHVITREQCETHYGAAIAN 202
            +CLP     RN  +        GWG+LRY G  S  L +V + V+  + C+  Y + +++
Sbjct  116  ICLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAY-SDVSD 174
Query  203  ANLLCTFDVGR-DACQNDSGGPILWRSPTTDNLILVGVVNFGRTCA-DDAPGGNARVTSF 260
              +   +  GR D+CQ DSGGP++   P       +GVV++G  CA    PG   RVTS+
Sbjct  175  TVICAGYPKGRKDSCQGDSGGPLM--IPQESTYYEIGVVSYGHECALPKYPGVYTRVTSY 232
Query  261  ME-FI 264
            ++ FI
Sbjct  233  LDSFI 237

Sequence Alignment: 5. Allergen Name: Der f 3 Sequence ID: P49275

 Score = 87.1 bits 353,  Expect = 7e-19
 Identities = 78/215 36%, Positives = 123/215 57%, Gaps = 31/215 14%
Query  34   IVNGVETEINEFPMVARLIYPSPGMYCGGTIITPQHIVTAAHCL--QKYKRTNYTGIHVV 91
            IV GV+ +  + P    L   S   +CGG+I+    I+TAAHC+  Q  K+ +       
Sbjct  28   IVGGVKAQAGDCPYQISL--QSSSHFCGGSILDEYWILTAAHCVNGQSAKKLSIR----- 80
Query  92   VGEHDYTTDTETNVTKRYTIAEVTIHPNYNSH--NNDIAIVKTNERFEYSM-KVGPVCLP 148
                 Y T    +  ++  +AE+  H NY+S   +ND+A++K             PV LP
Sbjct  81   -----YNTLKHASGGEKIQVAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLP 135
Query  149  FNYMTRNLTNETVTALGWGKLRYNGQNS--KVLRKVDLHVITREQCETHYGAAIANA--N 204
                +     + +   GWG L+  G  S    L++VD+ V++REQC+  Y  A A+   N
Sbjct  136  -AQGSDVKVGDKIRVSGWGYLQ-EGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSEN 193
Query  205  LLCTFDV---GRDACQNDSGGPILWRSPTTDNLILVGVVNFGRTCADDA-PGGNARVTSF 260
            ++C  DV   G D+CQ DSGGP++     T  +  VG+V++G  CA    PG   RV +F
Sbjct  194  MICGGDVANGGVDSCQGDSGGPVV--DVATKQI--VGIVSWGYGCARKGYPGVYTRVGNF 249
Query  261  MEFIHN 266
            +++I +
Sbjct  250  VDWIES 255

Sequence Alignment: 6. Allergen Name: Der p 3 Sequence ID: P39675

 Score = 84.4 bits 341,  Expect = 5e-18
 Identities = 76/217 35%, Positives = 123/217 56%, Gaps = 27/217 12%
Query  34   IVNGVETEINEFPMVARLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTNYTGIHVVVG 93
            IV G +    E P    L   S   +CGGTI+    I+TAAHC+        T   + + 
Sbjct  30   IVGGEKALAGECPYQISL--QSSSHFCGGTILDEYWILTAAHCV-----AGQTASKLSI- 81
Query  94   EHDYTTDTETNVTKRYTIAEVTIHPNYNSH--NNDIAIVKTNERFEYSMK-VGPVCLPFN 150
               Y +   +   ++ ++A++  H  Y+S+  +NDIA++K     + + K    V LP  
Sbjct  82   --RYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAK 139
Query  151  YMTRNLTNETVTALGWGKLRYNGQNS--KVLRKVDLHVITREQCETHYGAAIANA--NLL 206
                 + ++ V   GWG L   G  S    LR+VD+ V++R++C   Y  A A    N++
Sbjct  140  GSDVKVGDQ-VRVSGWGYLE-EGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMI 197
Query  207  CTFDV---GRDACQNDSGGPILWRSPTTDNLILVGVVNFGRTCADDA-PGGNARVTSFME 262
            C  DV   G+D+CQ DSGGP++      +N + VG+V++G  CA    PG   RV +F++
Sbjct  198  CGGDVANGGKDSCQGDSGGPVV---DVKNNQV-VGIVSWGYGCARKGYPGVYTRVGNFID 253
Query  263  FIHN 266
            +I +
Sbjct  254  WIES 257

Sequence Alignment: 7. Allergen Name: Eur m 3 Sequence ID: O97370

 Score = 82.3 bits 332,  Expect = 2e-17
 Identities = 83/239 34%, Positives = 132/239 55%, Gaps = 36/239 15%
Query  3    CGKIILLFITIIGVAKSREENCKCGWDNPS-RIVNGVETEINEFPMVARLIYPSPGMYCG 61
            C  II+L++    +A     +      +P+  IV G + +  E P    L   S   +CG
Sbjct  4    CNAIIVLLLAFNTLANPILPS------SPNATIVGGQKAKAGECPYQISL--QSSSHFCG 55
Query  62   GTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYN 121
            GTI+    I+TAAHC+        T   + +    Y +    +  ++ ++A++  H  Y+
Sbjct  56   GTILDEYWILTAAHCVN-----GQTASKLSI---RYNSLKHASGGEKLSVAQIYQHEKYD 107
Query  122  SH--NNDIAIVKTNERFEYSMK-VGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNS-- 176
            S   +NDIA++K         K    V LP +  +     + V   GWG L+  G  S  
Sbjct  108  SWTIDNDIALIKLQSPMTLDQKNAKSVQLP-SQGSDVKVGDKVRVSGWGYLK-EGSYSLP 165
Query  177  KVLRKVDLHVITREQCETHY---GAAIANANLLCTFDV---GRDACQNDSGGPILWRSPT 230
              + +VD+ ++ REQC   Y   GA I + N++C  +V   G D+CQ DSGGP++     
Sbjct  166  SDMYRVDIDIVAREQCNKLYEEAGATITD-NMICGGNVADGGVDSCQGDSGGPVV---DV 221
Query  231  TDNLILVGVVNFGRTCADDA-PGGNARVTSFMEFI 264
              N I VG+V++G  CA    PG   RV SF+++I
Sbjct  222  ASNQI-VGIVSWGYGCARKGYPGVYTRVGSFIDWI 255

Sequence Alignment: 8. Allergen Name: Blo t 3.0101 Sequence ID: AAM10779

 Score = 80.2 bits 323,  Expect = 8e-17
 Identities = 79/247 31%, Positives = 131/247 53%, Gaps = 34/247 13%
Query  5    KIILLF--ITIIGVAKSREENCKCGWDN---PSRIVNGVETEINEFPMVARLIYPSPGMY 59
            K+++LF  +++      ++   K   D       IV G      + P    L   S   +
Sbjct  2    KVLVLFCLVSLAAAGPLKDALNKAQVDAFYAEGYIVGGSNAADGDAPYQVSLQRTS--HF 59
Query  60   CGGTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPN 119
            CGG+II   +I+TAAHC+Q    ++ T          Y T    +       + +  H  
Sbjct  60   CGGSIIADNYILTAAHCIQGLSASSLT--------TRYNTLRHNSGGLTVKASRIIGHEK 111
Query  120  YNSH--NNDIAIVKTNERFEY-SMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNS 176
            Y+S+  +NDIA+++T  +    +     + LP        ++E V   GWG L  +G +S
Sbjct  112  YDSNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPKASSE-VLITGWGTLS-SGASS 169
Query  177  --KVLRKVDLHVITREQCETHYGAAIANA--NLLCT--FDVG-RDACQNDSGGPILWRSP 229
                L+KV + ++ R+ C  +YGA  A    N++C   ++VG +DACQ DSGGP+     
Sbjct  170  LPTKLQKVTVPIVDRKTCNANYGAVGAEITDNMFCAGILNVGGKDACQGDSGGPV----- 224
Query  230  TTDNLILVGVVNFGRTCADDA-PGGNARVTSFMEFIHNATI 269
               N +LVG V++G  CA    PG   RV +++ +I    +
Sbjct  225  -AANGVLVGAVSWGYGCAQAKYPGVYTRVGNYISWIKGKGV 264

Sequence Alignment: 9. Allergen Name: Tyr p 3.0101 Sequence ID: ABZ81991

 Score = 73.6 bits 294,  Expect = 9e-15
 Identities = 74/244 30%, Positives = 128/244 52%, Gaps = 28/244 11%
Query  5    KIILLFITIIGVAKSREENCKCGWDNPSR---IVNGVETEINEFPMVARLIYPSPGMYCG 61
            KI+L++  ++ VA ++    +   +  S+   IV G E    + P    L + S   +CG
Sbjct  2    KILLFLCFLVSVAFAKPPTIQLKSNTKSQNGFIVGGTEAVDGDAPHQVSLQHTS--HFCG 59
Query  62   GTIITPQHIVTAAHCLQKYKRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYN 121
            G+II+ + I+TAAHC+     +N  G+ V     +  + T   V        + +H  Y+
Sbjct  60   GSIISERWILTAAHCIDADDLSNPGGMSVRYNTLNLKSGTLVKVKS------IKVHEQYS 113
Query  122  --SHNNDIAIVKTNERFEYSMKVGPVCLPFNYMTRNLTNETVTALGWGKLRYNGQNS--K 177
              + +NDIA+++T      + +   V   +     +  +  +   GWG L ++G  +   
Sbjct  114  NVTSDNDIALLETVASMNLN-QTNAVAAKLPAKGNDPQDGDLFLSGWGTL-HSGDTTIPT 171
Query  178  VLRKVDLHVITREQC-ETHYGAAIANANLLCTFDVG---RDACQNDSGGPILWRSPTTDN 233
             L+KV + +  R  C E + G      N++C   +G    D+CQ DSGG  +       N
Sbjct  172  NLQKVTVPLTNRSVCAEAYTGIVNITENMFCAGKMGIGGVDSCQGDSGGGAML------N 225
Query  234  LILVGVVNFGRTCADDA-PGGNARVTSFMEFI 264
              LVGVV+FG  C D   PG   RV+ ++++I
Sbjct  226  KELVGVVSFGVGCGDPKYPGVYTRVSQYLDWI 257

Sequence Alignment: 10. Allergen Name: Blo t 6.0101 Sequence ID: AAQ24544

 Score = 59.5 bits 232,  Expect = 2e-10
 Identities = 58/198 29%, Positives = 100/198 50%, Gaps = 23/198 11%
Query  30   NPSRIVNGVETEINEFP-----MVARLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTN 84
            N  R+V G + +  E P     M   LI  S    CGG++ITPQ +VTAAHC     +T 
Sbjct  43   NSPRVVGGTDAKKAEAPFQISLMKDYLILKS--HICGGSLITPQTVVTAAHCTD--GQTA 98
Query  85   YTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNSHNNDIAIVKTNERFEYSMKVGP 144
             + I+ + G +  +     ++  +  +      P  N+  NDI+++        S  V  
Sbjct  99   SSLINRL-GTNQRSKPGIPDIKTKRIVQHEQYDP--NTIENDISLLILASPITPSDTVKV 155
Query  145  VCLPFNYMTRNLTNETVTALGWGKLRYNGQN-SKVLRKVDLHVITREQCETHYGAA-IAN 202
            + +    +      E V   GWG    N Q+  + L+  +L ++++E+C   +G      
Sbjct  156  IAIEETNLN---GGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVNTIK 212
Query  203  ANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVVNFG 243
              ++C +     AC  DSGGP+++      N  L G+V++G
Sbjct  213  PGMICALAPSTQACNGDSGGPLVY------NGKLAGIVSWG 247

Sequence Alignment: 11. Allergen Name: Der p 9.0101 Sequence ID: AAP57077

 Score = 55.4 bits 214,  Expect = 3e-09
 Identities = 60/224 26%, Positives = 111/224 49%, Gaps = 22/224 9%
Query  29   DNPSRIVNGVETEINEFPMVARLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTNYTGI 88
            D   RIV G      +  +    ++      CGG++I+ + ++TAAHC+   + T  +  
Sbjct  45   DERERIVGGSNASPGD-AVYQIALFRKDSFTCGGSLISSRTVLTAAHCVFGDEATP-SYF 102
Query  89   HVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNSH--NNDIAIVKTNERFEYSMKVGPVC 146
             +     D T      V+K Y       H  Y+S   + D+A +  ++ F  S     + 
Sbjct  103  KIRYNTLDRTNGPPIGVSKIYR------HNLYSSSPIDYDVATLILSQPFTPSANADII- 155
Query  147  LPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLRKVDLHVITREQCETHYGAAIANAN-L 205
             P+   +       +   GWG+L+  G    +L+   +  ++R +C + +G+  A  N +
Sbjct  156  -PLT-TSEPADGTKLQITGWGRLKSGGTLPTILQIASVTKMSRTKCSSTWGSVNAITNRM 213
Query  206  LCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVVNFG-RTC-ADDAPGGNARVTSFMEF 263
            LC  +  + +C  DSGGP++       N  LVGVV++G  TC +   P   + V ++  +
Sbjct  214  LCAHNSNQASCNGDSGGPLV------SNGHLVGVVSWGPSTCLSTKYPTIYSNVANLRNW 267
Query  264  IHNATI 269
            I + T+
Sbjct  268  IISNTV 273

Sequence Alignment: 12. Allergen Name: Der f 6 Sequence ID: P49276

 Score = 55.1 bits 213,  Expect = 3e-09
 Identities = 54/207 26%, Positives = 109/207 52%, Gaps = 25/207 12%
Query  29   DNP-SRIVNGVETEINEFPMVARLIYPSPGM---YCGGTIITPQHIVTAAHCLQKYKRTN 84
            D+P + +V G + ++ E P    L+     M    CGG++I+   +VTAAHC    K ++
Sbjct  44   DSPIAGVVGGQDADLAEAPFQISLLKDYLIMKRHMCGGSLISESTVVTAAHCTYGQKASS 103
Query  85   YTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNSHNNDIAIVKTNERFEYSMKVGP 144
               + V  G +  T+ +  ++  +  I   +   +    +  I I+        ++++  
Sbjct  104  ---LSVRYGTNQRTSSSYGDLKVKPIIQHESYEQDQTQTDKTIIILPNPVVPSTNVQMNE 160
Query  145  VCLPFNYMTRNLTN-ETVTALGWGKLRYNGQN-SKVLRKVDLHVITREQCETHYGAAIA- 201
            +       T ++ + + VT  GWG    NG++    L+K  + ++  ++C   +G+  A 
Sbjct  161  I------ETEDIVDGDKVTIYGWGLTDGNGKDLPDKLQKGSMTIVGNDRCNEKWGSINAI 214
Query  202  NANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVVNFGRT-CADDAPG 252
            +  ++C +D  +  C  DSGGP++     + N  L G+V++G + C    PG
Sbjct  215  HPGMICALDKTQSGCNGDSGGPLV-----SANRKLTGIVSWGPSKCP---PG 258

Sequence Alignment: 13. Allergen Name: Der p 9.0102 Sequence ID: AAN02511

 Score = 54.9 bits 212,  Expect = 3e-09
 Identities = 47/186 25%, Positives = 89/186 47%, Gaps = 14/186 7%
Query  29   DNPSRIVNGVETEINEFPMVARLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTNYTGI 88
            D   RIV G      +  +    ++      CGG++I+ + ++TAAHC+   + T  +  
Sbjct  59   DERERIVGGSNASPGD-AVYQIALFRKDSFTCGGSLISSRTVLTAAHCVFGDEATP-SYF 116
Query  89   HVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNSH--NNDIAIVKTNERFEYSMKVGPVC 146
             +     D T      V+K Y       H  Y+S   + D+A +  ++ F  S     + 
Sbjct  117  KIRYNTLDRTNGPTIGVSKIYR------HNLYSSSTIDYDVATLILSQPFTPSANADII- 169
Query  147  LPFNYMTRNLTNETVTALGWGKLRYNGQNSKVLRKVDLHVITREQCETHYGAAIANAN-L 205
             P+   +       +   GWG+L+  G    +L+   +  ++R +C + +G+  A  N +
Sbjct  170  -PLT-TSEPADGTKLQITGWGRLKSGGTLPTILQIASVTKMSRTKCSSTWGSVNAITNRM 227
Query  206  LCTFDVGRDACQNDSGGPIL 225
            LC  +  + +C  DSGGP++
Sbjct  228  LCAHNSKQASCNGDSGGPLV 247

Sequence Alignment: 14. Allergen Name: Can f 5.0101 Sequence ID: P09582

 Score = 52.9 bits 203,  Expect = 1e-08
 Identities = 64/227 28%, Positives = 109/227 48%, Gaps = 40/227 17%
Query  27   GWDN--PS---RIVNGVETEINEFP-MVARLIYPSPGMYCGGTIITPQHIVTAAHCLQKY 80
            GW    P    RI+ G E   N  P  VA  +Y +    CGG ++ P+ ++TAAHC    
Sbjct  13   GWTGAEPHFQPRIIGGRECLKNSQPWQVA--VYHNGEFACGGVLVNPEWVLTAAHCAN-- 68
Query  81   KRTNYTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNSHNNDIAIVKTNERFEYSM 140
                 +   V +G H+ +   +    +   + +  IHP Y +     A+++  E   + +
Sbjct  69   -----SNCEVWLGRHNLSESEDEG--QLVQVRKSFIHPLYKTKVPR-AVIRPGEDRSHDL 120
Query  141  KV----GPVCLPFNYMTRNLTNE------TVTALGWGKLRYNGQ-NSKVLRKVDLHVITR 189
             +     P  +       +L  +      T    GWG        +   L+ VDL +++ 
Sbjct  121  MLLHLEEPAKITKAVRVMDLPKKEPPLGSTCYVSGWGSTDPETIFHPGSLQCVDLKLLSN 180
Query  190  EQCETHYGAAIANANLLCT--FDVGRDACQNDSGGPILWRSPTTDNLILVGVVNFGRT-C 246
             QC   Y   +    +LC   ++  +D C+ DSGGP++      D   LVG+ ++G T C
Sbjct  181  NQCAKVYTQKVTKF-MLCAGVLEGKKDTCKGDSGGPLI-----CDGE-LVGITSWGATPC 233
Query  247  AD-DAPGGNARVTSFMEFIHNATIGET 272
                 P    RV   + +I +     T
Sbjct  234  GKPQMPSLYTRVMPHLMWIKDTMKANT 260

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.