The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKST
ISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYST
AVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNI
DGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR
FFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPA
RGSFYVPVEATAPYCHNEGIKL
Sequence Info Allergen Name Length Opt Bits Score E Value
ABN13879 Poly p 1.0101 322 2205 509.1 9.3e-146
Q9U6W0 Pol a 1 301 1707 395.6 1.3e-111
AAS67042 Pol d 1.0102 316 1700 394.0 4.1e-111
AAS67041 Pol d 1.0101 337 1696 393.1 8.3e-111
AAS67043 Pol d 1.0103 316 1692 392.2 1.4e-110
AAS67044 Pol d 1.0104 316 1685 390.6 4.4e-110
P49369 Ves v 1 336 1368 318.3 2.7e-88
P51528 Ves m 1 300 1333 310.4 5.8e-86
3989146 Pol e 1.0101 302 1320 307.4 4.6e-85
C0HLL3 Vesp v 1.0101 304 1272 296.5 9.1e-82
P53357 Dol m 1.02 303 1271 296.2 1.1e-81
Q06478 Dol m 1.0101 317 1239 288.9 1.8e-79
ACA00159 Vesp c 1.0101 301 1199 279.8 9.2e-77
3989146 Ves s 1.0101 298 1158 270.5 5.9e-74
AAT95008 Sol i 1.0101 346 494 119.1 2.6e-28
P83542 Pol g 1.0101 42 177 51.7 5.9e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 509.1 bits 2205,  Expect = 9e-146
 Identities = 322/322 100%, Positives = 322/322 100%, Gaps = 0/322 0%
Query  1    MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKST 60
            MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKST
Sbjct  1    MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKST 60
Query  61   ISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYST 120
            ISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYST
Sbjct  61   ISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYST 120
Query  121  AVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNI 180
            AVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNI
Sbjct  121  AVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNI 180
Query  181  DGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR 240
            DGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR
Sbjct  181  DGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR 240
Query  241  FFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPA 300
            FFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPA
Sbjct  241  FFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPA 300
Query  301  RGSFYVPVEATAPYCHNEGIKL 322
            RGSFYVPVEATAPYCHNEGIKL
Sbjct  301  RGSFYVPVEATAPYCHNEGIKL 322

Sequence Alignment: 2. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 395.6 bits 1707,  Expect = 1e-111
 Identities = 245/299 81%, Positives = 269/299 89%, Gaps = 3/299 1%
Query  21   PECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNEN 80
            P+C FNE DI+F+VY+R +RDGI+L +ETL NYDLF KSTIS+QVVF+ HGFLS GNNEN
Sbjct  3    PDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKSTISKQVVFLIHGFLSTGNNEN 62
Query  81   FIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLV 140
            F+AM+KALIEKD+FLVISVDWKKGACNAFAST D LGYS AVGNTRHVGK+VADFTKLLV
Sbjct  63   FVAMSKALIEKDDFLVISVDWKKGACNAFASTKDALGYSKAVGNTRHVGKFVADFTKLLV 122
Query  141  EQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLC 200
            E+YKV +SNIRLIGHSLGAHTSGFAGKEVQ+LKL KY  I GLDPAGP F  +DCP+RLC
Sbjct  123  EKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPDRLC 182
Query  201  ETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIK 260
             TDAEYVQ+IHTS ILGVY  +G+VDFY+NYG +QPGC     PSCSHTKAVKYLTECIK
Sbjct  183  VTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNE---PSCSHTKAVKYLTECIK 239
Query  261  HECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEGI 320
            HECCLIGTPWKKYFSTPKPISQC  DTCVCVGLNAKSYPARG+FY PVEA APYCHNEGI
Sbjct  240  HECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEGI 299
Query  321  KL 322
            KL
Sbjct  300  KL 301

Sequence Alignment: 3. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 394.0 bits 1700,  Expect = 4e-111
 Identities = 247/307 80%, Positives = 266/307 86%, Gaps = 3/307 0%
Query  13   GTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGF 72
            GTLDRG+ P+C FNE DI + VY+R +R+GI+L +E L+NYDLF+KS IS Q+  + HGF
Sbjct  10   GTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGF 69
Query  73   LSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYV 132
            LS GNNENF AMAKALIE DNFLVISVDWKKGACNAFAST D LGYS AVGNTRHVGKYV
Sbjct  70   LSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYV 129
Query  133  ADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDS 192
            ADFTKLLVEQYKV MSNIRLIGHSLGAHTSGFAGKEVQ LKL KY  I GLDPAGPSF +
Sbjct  130  ADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLT 189
Query  193  NDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAV 252
            N CP RLCETDAEYVQ IHTS ILGVY  +G+VDFY+NYG  QPGC     PSCSHTKAV
Sbjct  190  NKCPNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAV 246
Query  253  KYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATA 312
            KYLTECIK ECCLIGTPWK YFSTPKPISQC +DTCVCVGLNA+SYPA+GSFYVPVE  A
Sbjct  247  KYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDA 306
Query  313  PYCHNEGIKL 322
            PYCHNEGIKL
Sbjct  307  PYCHNEGIKL 316

Sequence Alignment: 4. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 393.1 bits 1696,  Expect = 8e-111
 Identities = 258/319 80%, Positives = 278/319 87%, Gaps = 21/319 6%
Query  1    MNFKYSILFICF------------------GTLDRGLIPECPFNEYDILFFVYTRQQRDG 42
            MNFKYSILFICF                  GTLDRG+ P+C FNE DI + VY+R +R+G
Sbjct  1    MNFKYSILFICFVKVLDNCYAADDLTTLRNGTLDRGITPDCTFNEKDIELHVYSRDKRNG 60
Query  43   IVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWK 102
            I+L +E L+NYDLF+KS IS Q+  + HGFLS GNNENF AMAKALIE DNFLVISVDWK
Sbjct  61   IILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNENFDAMAKALIEIDNFLVISVDWK 120
Query  103  KGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTS 162
            KGACNAFAST D LGYS AVGNTRHVGKYVADFTKLLVEQYKV MSNIRLIGHSLGAHTS
Sbjct  121  KGACNAFASTNDVLGYSQAVGNTRHVGKYVADFTKLLVEQYKVPMSNIRLIGHSLGAHTS 180
Query  163  GFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKI 222
            GFAGKEVQ LKL KY  I GLDPAGPSF +N CP RLCETDAEYVQ IHTS ILGVY  +
Sbjct  181  GFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRLCETDAEYVQAIHTSAILGVYYNV 240
Query  223  GTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQ 282
            G+VDFY+NYG  QPGC     PSCSHTKAVKYLTECIK ECCLIGTPWK YFSTPKPISQ
Sbjct  241  GSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECIKRECCLIGTPWKSYFSTPKPISQ 297
Query  283  CTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEGIKL 322
            C +DTCVCVGLNA+SYPA+GSFYVPV+  APYCHNEGIKL
Sbjct  298  CKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEGIKL 337

Sequence Alignment: 5. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 392.2 bits 1692,  Expect = 1e-110
 Identities = 245/307 79%, Positives = 267/307 86%, Gaps = 3/307 0%
Query  13   GTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGF 72
            GTLDRG+ P+C FNE DI + VY+R +R+GI+L +E L+NYDLF+KS IS Q+  + HGF
Sbjct  10   GTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGF 69
Query  73   LSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYV 132
            LS GNNENF AMAKALIE DNFLVISVDWKKGACNAFAST D LGYS AVGNTRHVGKYV
Sbjct  70   LSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYV 129
Query  133  ADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDS 192
            ADFTKLLVEQYKV MSNIRLIGHSLGAHTSGFAGKEVQ LKL KY  I GLDPAGPSF +
Sbjct  130  ADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLT 189
Query  193  NDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAV 252
            + CP+RLCETDAEYVQ IHTS ILGVY  +G+VDFY+NYG  QPGC     PSCSHTKAV
Sbjct  190  SKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAV 246
Query  253  KYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATA 312
            KYLTECIK ECCLIGTPWK YFSTPKPISQC +DTCVCVGLNA+SYPA+GSFYVPV+  A
Sbjct  247  KYLTECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDA 306
Query  313  PYCHNEGIKL 322
            PYCHNEGIKL
Sbjct  307  PYCHNEGIKL 316

Sequence Alignment: 6. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 390.6 bits 1685,  Expect = 4e-110
 Identities = 245/307 79%, Positives = 266/307 86%, Gaps = 3/307 0%
Query  13   GTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGF 72
            GTLDRG+ P+C FNE DI + VY+R +R+GI+L +E L+NYDLF+KS IS Q+  + HGF
Sbjct  10   GTLDRGITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGF 69
Query  73   LSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYV 132
            LS GNNENF AMAKALIE DNFLVISVDWKKGACNAFAST D LGYS AVGNTRHVGKYV
Sbjct  70   LSTGNNENFDAMAKALIEIDNFLVISVDWKKGACNAFASTNDVLGYSQAVGNTRHVGKYV 129
Query  133  ADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDS 192
            ADFTKLLVEQYKV MSNIRLIGHSLGAHTSGFAGKEVQ LKL KY  I GLDPAGPSF +
Sbjct  130  ADFTKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLT 189
Query  193  NDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAV 252
            + CP+RLCETDAEYVQ IHTS ILGVY  +G+VDFY+NYG  QPGC     PSCSHTKAV
Sbjct  190  SKCPDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAV 246
Query  253  KYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATA 312
            KYLTECIK ECCLIGTPWK YFSTPK ISQC +DTCVCVGLNA+SYPA+GSFYVPVE  A
Sbjct  247  KYLTECIKRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDA 306
Query  313  PYCHNEGIKL 322
            PYCHNEGIKL
Sbjct  307  PYCHNEGIKL 316

Sequence Alignment: 7. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 318.3 bits 1368,  Expect = 3e-88
 Identities = 206/314 65%, Positives = 249/314 79%, Gaps = 20/314 6%
Query  1    MNFKYSILFI--------CFG-------TLDRGLIPECPFNEYDILFFVYTRQQRDGIVL 45
            MN+KY +LF+        C+G        LDRG  P+CPFN   +   + TR+ R+  + 
Sbjct  5    MNLKYLLLFVYFVQVLNCCYGHGDPLSYELDRG--PKCPFNSDTVSIIIETRENRNRDLY 62
Query  46   TEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGA 105
            T +TLQN+  FKK TI+R VVFI HGF S+ +  NFI +AKAL++KDN++VIS+DW+  A
Sbjct  63   TLQTLQNHPEFKKKTITRPVVFITHGFTSSASETNFINLAKALVDKDNYMVISIDWQTAA 122
Query  106  CNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFA 165
            C   A+ L YL Y TA  NTR VG+Y+A  T+ LV++YK+SM+NIRLIGHSLGAH SGFA
Sbjct  123  CTNEAAGLKYLYYPTAARNTRLVGQYIATITQKLVKHYKISMANIRLIGHSLGAHASGFA 182
Query  166  GKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTV 225
            GK+VQELKL KYS I GLDPA PSFDSN C ERLCETDAEYVQIIHTSN LG    +GTV
Sbjct  183  GKKVQELKLGKYSEIIGLDPARPSFDSNHCSERLCETDAEYVQIIHTSNYLGTEKTLGTV 242
Query  226  DFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTK 285
            DFYMN G +QPGCGRFFS  CSH++AV Y+ ECIKHECCLIG P  K   + +PIS CTK
Sbjct  243  DFYMNNGKNQPGCGRFFSEVCSHSRAVIYMAECIKHECCLIGIPKSK---SSQPISSCTK 299
Query  286  DTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEG 319
              CVCVGLNAK YP+RGSFYVPVE+TAP+C+N+G
Sbjct  300  QECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 333

Sequence Alignment: 8. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 310.4 bits 1333,  Expect = 6e-86
 Identities = 192/296 64%, Positives = 229/296 77%, Gaps = 3/296 1%
Query  21   PECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNEN 80
            P+CPFN   +   + TR+ R+  + T +TLQN+  FKK TI+R VVFI HGF S+ + +N
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
Query  81   FIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLV 140
            FI +AKAL++KDN++VIS+DW+  AC      L Y  Y TA  NTR VG+Y+A  T+ LV
Sbjct  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLV 121
Query  141  EQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLC 200
            + YK+SM+NIRLIGHSLGAH SGFAGK VQELKL KYS I GLDPA PSFDSN C ERLC
Sbjct  122  KDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLC 181
Query  201  ETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIK 260
            ETDAEYVQIIHTSN LG    +GTVDFYMN G + PGCGRFFS  CSHT+AV Y+ ECIK
Sbjct  182  ETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECIK 241
Query  261  HECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEG 319
            HECCLIG P  K   + +PIS+CTK  CVCVGLNAK YP+RGSFYVPVE+TAP+C+N+G
Sbjct  242  HECCLIGIPRSK---SSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297

Sequence Alignment: 9. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 307.4 bits 1320,  Expect = 5e-85
 Identities = 193/301 64%, Positives = 228/301 75%, Gaps = 5/301 1%
Query  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKS-TISRQVVFIDHGFLSNG 76
            G+ P+C FNE DI+F+VY+R +RDGI+L +++L NYDLF KS T+S+QVVF+ HGFL++ 
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
Query  77   NNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFT 136
                  +++ ALIE D+FLV+SVDWKK            LGYS        +G YVADFT
Sbjct  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
Query  137  KLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCP 196
            KL + +YKV     R IGHSLGAHTSGFAGKEVQ+LKL KY  I GLDPAGPSF ++ CP
Sbjct  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
Query  197  ERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLT 256
            +RLCE+  +Y QI+HTS   GVY  +G+VDFY+NYG  QPGC     PSC   KA KYLT
Sbjct  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLT 237
Query  257  ECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCH 316
            ECIK ECCLI TPW KYFSTPKPISQC +DTCVCVGLNAKSYPARG+FY PVEA APYCH
Sbjct  238  ECIKEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCH 296
Query  317  NEGIKL 322
            NEGIKL
Sbjct  297  NEGIKL 302

Sequence Alignment: 10. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 296.5 bits 1272,  Expect = 9e-82
 Identities = 180/302 59%, Positives = 235/302 77%, Gaps = 5/302 1%
Query  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISR-QVVFIDHGFLSNG 76
            GL+P+C +    I F + TR+ R+G+ LT ++L+   ++ KS +S  QVVF+ HGF+S+ 
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
Query  77   NNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFT 136
            NN N++ M KAL+EK++ +VIS+DW+ GAC      L ++GY  AV NTR VGKY+ADF+
Sbjct  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
Query  137  KLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCP 196
            KLL+++YKVS++NIRLIGHSLGA+ +GFAGKE Q++KL KY  I GLDPAGP F SNDC 
Sbjct  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
Query  197  ERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR-FFSPSCSHTKAVKYL 255
            +R+CETDA YVQIIHTSN LG    +GTVDFYMN G +QPGC   F   +CSHT+AV+Y+
Sbjct  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
Query  256  TECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYC 315
            TECI+HECCLIG P  K    P+P+S+CT++ CVCVGLNAK YP  GSFYVPVE+ APYC
Sbjct  241  TECIRHECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYC 297
Query  316  HNEGIKL 322
            +N+G K+
Sbjct  298  NNKGKKI 304

Sequence Alignment: 11. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 296.2 bits 1271,  Expect = 1e-81
 Identities = 175/299 58%, Positives = 231/299 77%, Gaps = 4/299 1%
Query  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTIS-RQVVFIDHGFLSNG 76
            G++PEC +   +I F + TR+ RDG+ LT + L+N  +FK S +S ++V F+ HGF+S+ 
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
Query  77   NNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFT 136
             N+N+  M +AL++KD+ +VIS+DW+ GAC+   + L ++GY  AV NTR VGKY+ADF+
Sbjct  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
Query  137  KLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCP 196
            K+L+++YKV + NIRLIGHSLGA+ +GFAGKE Q +KL KY  I GLDPAGPSF   DCP
Sbjct  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
Query  197  ERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLT 256
            ER+CETDA YVQI+HTS+ LG    +GTVDFY+N GS+QPGC      +CSHT+AVKYLT
Sbjct  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT 240
Query  257  ECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCH 316
            ECI+ ECCLIG P  K    P+P+S+CT++ CVCVGLNAK YP +GSFYVPVEA AP+C+
Sbjct  241  ECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCN 297
Query  317  NEG 319
            N G
Sbjct  298  NNG 300

Sequence Alignment: 12. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 288.9 bits 1239,  Expect = 2e-79
 Identities = 179/300 59%, Positives = 218/300 72%, Gaps = 5/300 1%
Query  15   LDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLS 74
            LDR  +  CPF+   +     TR+ R     T +T+  ++ FKKS I R VVFI HGF S
Sbjct  15   LDRFSV--CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKSIIKRPVVFITHGFTS 72
Query  75   NGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVAD 134
            +   +NF+AM++AL+   +FL+I VDW+  AC      L Y+ Y  AVGNTR VG ++A 
Sbjct  73   SATEKNFVAMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAM 132
Query  135  FTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSND 194
              K LVEQYKV M+NIRL+GHSLGAH SGFAGK VQELKL K+S I GLDPAGPSF  ND
Sbjct  133  IAKKLVEQYKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKND 192
Query  195  CPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKY 254
            C ER+CETDA YVQI+HTS+ LG    +GTVDFY+N GS+QPGC      +CSHT+AVKY
Sbjct  193  CSERICETDAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRYIIGETCSHTRAVKY 252
Query  255  LTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPY 314
            +TECI+ ECCLIG P  K    P+P+S+CT++ CVCVGLNAK YP RGSFYVPVEA APY
Sbjct  253  FTECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPY 309
Query  315  CHNEG 319
            C+N G
Sbjct  310  CNNNG 314

Sequence Alignment: 13. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 279.8 bits 1199,  Expect = 9e-77
 Identities = 173/294 58%, Positives = 215/294 73%, Gaps = 4/294 1%
Query  23   CPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFI 82
            CP+++  +   V TR+ +     T +T++N++ FK +   +  VFI HGF S+   ENF+
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEFKDTITLKPHVFITHGFTSSATAENFV 63
Query  83   AMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQ 142
             MAKAL++K N+LVI  DW+  AC    + L    Y  A  NTR VG Y+A  TK+LV++
Sbjct  64   VMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQK 123
Query  143  YKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCET 202
            Y V M+NIRLIGHSLGAH SGFAGK+VQEL L KY  I GLDPAGPSF SNDC +R+CET
Sbjct  124  YNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICET 183
Query  203  DAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGR-FFSPSCSHTKAVKYLTECIKH 261
            DA YVQIIHTSN LG    +GTVDFYMN G +QPGCG      +CSHT+AVKY+TECIKH
Sbjct  184  DANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIKH 243
Query  262  ECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEG 319
            ECCLIG P  K    P+P+S+CT++ CVCVGLNAK+YP  GSFYVPVE+ APYC+N+G
Sbjct  244  ECCLIGVPKSK---NPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKG 298

Sequence Alignment: 14. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 270.5 bits 1158,  Expect = 6e-74
 Identities = 172/292 58%, Positives = 213/292 72%, Gaps = 7/292 2%
Query  22   ECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENF 81
            +CPF++  +   + TR+ R+    T +TL+N+D FKK  I+R VVFI HGF S+   E+F
Sbjct  3    KCPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKKAITRPVVFITHGFTSSATVESF 62
Query  82   IAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVE 141
            + +  A++E     V   DW+  ACN    T   L Y TAV NTR VG+Y+A  TK LV 
Sbjct  63   VDLQTAILEXXXXKVTVSDWRVAACN---RTTGLLYYVTAVSNTRLVGRYIATVTKKLVT 119
Query  142  QYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCE 201
             Y VSM++IRLIGHSLGAH SGFAGKEVQ+LKL KYS I GLDPAGPSF+SNDC ERLC+
Sbjct  120  DYNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERLCK 179
Query  202  TDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRF-FSPSCSHTKAVKYLTECIK 260
            TDA YVQIIHTS  +G+   IG VDFY+N G++QPGCG   +   CSH++A+ Y+TECIK
Sbjct  180  TDAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTECIK 239
Query  261  HECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEG 319
             ECCLIG P  K   + K IS CT+  CVCVGL AKSYP  GSFYVPVE+TAP+C+N+G
Sbjct  240  RECCLIGIPQSK---SSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKG 295

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 119.1 bits 494,  Expect = 3e-28
 Identities = 99/290 34%, Positives = 150/290 51%, Gaps = 24/290 8%
Query  21   PECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKST-----ISRQVVFIDHGFLSN 75
            P+    EY     VY       + L    +Q  +L  + +      S  VVFI HGF S+
Sbjct  28   PDPGVVEYLKQSCVYGNSSYINVYLYNSRFQGKNLGNQQSCQDINASLPVVFITHGFTSS 87
Query  76   GNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADF 135
                 F  +A A+++K +   I VDW + AC      + +  Y+ A  NT  +G+ +A +
Sbjct  88   AQVSTFKDLANAFVQKGHTAFI-VDWSEAACTDGLPGVQFAEYNAAASNTYDIGQLMAKY 146
Query  136  TKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDC 195
            T  L+ + K+ ++NI+ +GHSLG+H  GFA K V++L       I  LDPA PSF SN C
Sbjct  147  TVDLMNKCKIPLNNIQYVGHSLGSHVCGFAAKHVKKLINKTMPYILALDPADPSFGSNKC 206
Query  196  PERLCETDAEYVQIIHTSNILGVYSKI-GTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKY 254
             ER+C++DA+ + +  TS ILG+   I G +    + G  QP C  +  P CSH++++ Y
Sbjct  207  GERICKSDAKRIVVFKTS-ILGIGENIIGHLLIVFDGGKSQPACSWYDVP-CSHSESIVY 264
Query  255  LTECIKHECCLIGTPWK-------------KYFSTPKPISQCTKDTCVCVGLNAKSYPAR 301
             T  +   C  +  PW              + F++  P    T DT  CV LN   +   
Sbjct  265  ATGMVSGRCQHLAVPWTAQQRINPIQWKFWRVFTSNIPAYP-TSDTTNCVVLNTNVFKND 323
Query  302  GSFYVPVEATAPYC 315
             +F     A  P C
Sbjct  324  NTFEGEYHAF-PDC 336

Sequence Alignment: 16. Allergen Name: Pol g 1.0101 Sequence ID: P83542

 Score = 51.7 bits 177,  Expect = 6e-09
 Identities = 24/42 57%, Positives = 34/42 80%, Gaps = 0/42 0%
Query  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKS 59
            G+ P+C FNE DI + VY+R +R+GI+L +E L+NYDLFK+S
Sbjct  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.