The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVA
PGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVD
ISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNG
PGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP
Sequence Info Allergen Name Length Opt Bits Score E Value
E3SU11 Ole e 13.0101 226 1654 361.8 1e-101
Q9ARG0 Cap a 1.0101 246 1099 243.0 6.4e-66
CAC34055 Cap a 1w 246 1099 243.0 6.4e-66
P81370 Act c 2 225 1091 241.3 1.9e-65
1Z3Q_A Mus a 4.0101 200 1074 237.7 2e-64
P12670 Lyc e NP24 247 1037 229.7 6.3e-62
AAG34078 Cap a 1 180 919 204.6 1.7e-54
P81295 Jun a 3 225 824 184.2 3e-48
AAR21074 Cup s 3.0102 225 822 183.8 4e-48
AAR21073 Cup s 3.0101 225 822 183.8 4e-48
CAC05258 Cup a 3 199 800 179.1 9e-47
AAF80165 Jun v 3.010102 97 404 94.6 1.2e-21
AAF80167 Jun v 3.010101 97 404 94.6 1.2e-21
CAC10270 Mal d 2 246 287 69.2 1.3e-13
ACE80959 Pru p 2.0101 246 264 64.3 4e-12
P50694 Pru av 2 245 250 61.3 3.2e-11
ACE80957 Pru p 2.0201 246 249 61.1 3.7e-11
ACE80955 Pru p 2.0301 242 243 59.8 8.8e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 361.8 bits 1654,  Expect = 1e-101
 Identities = 226/226 100%, Positives = 226/226 100%, Gaps = 0/226 0%
Query  1    MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVA 60
            MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVA
Sbjct  1    MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVA 60
Query  61   PGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVD 120
            PGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVD
Sbjct  61   PGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVD 120
Query  121  ISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNG 180
            ISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNG
Sbjct  121  ISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNG 180
Query  181  PGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226
            PGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP
Sbjct  181  PGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226

Sequence Alignment: 2. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 243.0 bits 1099,  Expect = 6e-66
 Identities = 147/212 69%, Positives = 171/212 80%, Gaps = 7/212 3%
Query  13   LWAITFFAYTHAATFDIVNQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWGR 71
            L+ + F  YT+AATF++ N C YTVWAA++P GGGRRLD+GQ+W IN  PGT  ARIWGR
Sbjct  10   LFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGR 69
Query  72   TNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPL 131
            TNCNFD +GRG C+TGDC G+L+C G+G+PPNTLAE+ALNQ NNLDF DIS VDGFNIP+
Sbjct  70   TNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPM 129
Query  132  EFSPTT---NVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTP 188
             F+PT      C  + C A I  +CP  LR PGGCNNPCT F   +YCCT GP  CGPT 
Sbjct  130  TFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGP--CGPTE 187
Query  189  LSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRVVFCP 226
            LS+FFK+RCPDAYSYPQDD TS FTCP+G TNYRVVFCP
Sbjct  188  LSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 3. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 243.0 bits 1099,  Expect = 6e-66
 Identities = 147/212 69%, Positives = 171/212 80%, Gaps = 7/212 3%
Query  13   LWAITFFAYTHAATFDIVNQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWGR 71
            L+ + F  YT+AATF++ N C YTVWAA++P GGGRRLD+GQ+W IN  PGT  ARIWGR
Sbjct  10   LFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGR 69
Query  72   TNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPL 131
            TNCNFD +GRG C+TGDC G+L+C G+G+PPNTLAE+ALNQ NNLDF DIS VDGFNIP+
Sbjct  70   TNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPM 129
Query  132  EFSPTT---NVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTP 188
             F+PT      C  + C A I  +CP  LR PGGCNNPCT F   +YCCT GP  CGPT 
Sbjct  130  TFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGP--CGPTE 187
Query  189  LSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRVVFCP 226
            LS+FFK+RCPDAYSYPQDD TS FTCP+G TNYRVVFCP
Sbjct  188  LSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 4. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 241.3 bits 1091,  Expect = 2e-65
 Identities = 146/224 65%, Positives = 177/224 79%, Gaps = 3/224 1%
Query  1    MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVA 60
            M+  K+L L   L+   +F     ATF+I+N C +TVWAAA PGGG+RLD+GQ+W IN  
Sbjct  1    MSTFKSLSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPG 60
Query  61   PGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVD 120
             GT  AR+W RT CNFD  GRG+C+TGDCNGLL+CQ +G+PPNTLAE+ALNQ NNLDF D
Sbjct  61   AGTKGARVWPRTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFD 120
Query  121  ISNVDGFNIPLEFSPTTNVCRRLV-CNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTN 179
            IS VDGFN+ +EFSPT+  C R + C A I  QCP+ELR PGGCNNPCTVF T++YCC +
Sbjct  121  ISLVDGFNVAMEFSPTSGGCTRGIKCTADINGQCPNELRAPGGCNNPCTVFKTDQYCCNS 180
Query  180  GPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226
              G+CG T +S+FFK+RCPDAYSYP+DD TS FTCPAGTNY+VVFCP
Sbjct  181  --GNCGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 225

Sequence Alignment: 5. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 237.7 bits 1074,  Expect = 2e-64
 Identities = 140/200 70%, Positives = 163/200 81%, Gaps = 2/200 1%
Query  25   ATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQC 84
            ATF+IVN+C+YTVWAAA PGGGR+L+QGQSW INV  GTT  RIWGRT C+FD +GRG+C
Sbjct  1    ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC 60
Query  85   ETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPLEFSPTTNVCRRLV 144
            +TGDC G+L C  YG PPNTLAEFALNQ NNLDF DIS VDGFN+P++FSPT+  CR + 
Sbjct  61   QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR 120
Query  145  CNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTPLSRFFKERCPDAYSYP 204
            C A I  QCP  L+ PGGCNNPCTVF T++YCC +  G+C PT  S+FFK  CPDAYSYP
Sbjct  121  CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNS--GACSPTDYSQFFKRNCPDAYSYP 178
Query  205  QDDPTSLFTCPAGTNYRVVFCP 226
            +DD T+ FTCP GTNYRVVFCP
Sbjct  179  KDDQTTTFTCPGGTNYRVVFCP 200

Sequence Alignment: 6. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 229.7 bits 1037,  Expect = 6e-62
 Identities = 140/212 66%, Positives = 167/212 78%, Gaps = 7/212 3%
Query  13   LWAITFFAYTHAATFDIVNQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWGR 71
            L+ +    YT+AAT ++ N C YTVWAA++P GGGRRL++GQ+W IN   GT  ARIWGR
Sbjct  10   LFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGR 69
Query  72   TNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPL 131
            T CNF+A GRG C+TGDC G+L+C G+G+PPNTLAE+AL+Q +NLDF DIS VDGFNIP+
Sbjct  70   TGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPM 129
Query  132  EFSPTT---NVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTP 188
             F+PT      C  + C A I  +CP  L+ PGGCNNPCT F   +YCCT GP  CGPT 
Sbjct  130  TFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGP--CGPTE 187
Query  189  LSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRVVFCP 226
            LS+FFK+RCPDAYSYPQDDPTS FTCP G TNYRVVFCP
Sbjct  188  LSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226

Sequence Alignment: 7. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 204.6 bits 919,  Expect = 2e-54
 Identities = 122/176 69%, Positives = 139/176 78%, Gaps = 6/176 3%
Query  31   NQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQCETGDC 89
            N C YTVWAAA+P GGG+RL++GQSW     PGT  ARIWGRTNCNFD  GRG C+TGDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
Query  90   NGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPLEFSPTT---NVCRRLVCN 146
             G+LEC+G+G+PPNTLAE+ALNQ +NLDF DIS +DGFNIP+ F PT      C  + C 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
Query  147  APIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTPLSRFFKERCPDAYSYPQD 206
            A I  +CP  LR PGGCNNPCT F   +YCCT GP  CGPT LSRFFK+RCPDAYSYPQD
Sbjct  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGP--CGPTDLSRFFKQRCPDAYSYPQD 178
Query  207  DP 208
            DP
Sbjct  179  DP 180

Sequence Alignment: 8. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 184.2 bits 824,  Expect = 3e-48
 Identities = 114/214 53%, Positives = 142/214 66%, Gaps = 6/214 2%
Query  9    LLVSLWAITFFAYTHAAT-FDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQAR 67
            LL +  AI++         FDI NQC YTVWAA  PGGG+RLDQGQ+W +N+A GT  AR
Sbjct  10   LLAATLAISLHMQEAGVVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASAR 69
Query  68   IWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGF 127
             WGRT C FDA+G+G C+TGDC G L C   G  P TLAE+     ++ D+ D+S VDGF
Sbjct  70   FWGRTGCTFDASGKGSCQTGDCGGQLSCTVSGAVPATLAEYT---QSDQDYYDVSLVDGF 126
Query  128  NIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGP-GSCGP 186
            NIPL  +PT   C    C A I   CPSEL+  GGCN+ C VF T++YCC N    +C  
Sbjct  127  NIPLAINPTNAQCTAPACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPA 186
Query  187  TPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226
            T  S+ FK +CP AYSY +DD T+ F C +GT+Y +VFCP
Sbjct  187  TNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYSIVFCP 225

Sequence Alignment: 9. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 183.8 bits 822,  Expect = 4e-48
 Identities = 114/214 53%, Positives = 143/214 66%, Gaps = 6/214 2%
Query  9    LLVSLWAITFFAYTHAAT-FDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQAR 67
            LLV+  AI++      A  FDI NQC YTVWAA  PGGG+RLDQGQ+W +N+A GT  AR
Sbjct  10   LLVATLAISLHMQEAGAVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASAR 69
Query  68   IWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGF 127
             WGRT C FDA+G+G C +GDC G L C   G  P TLAE+     ++ D+ D+S VDGF
Sbjct  70   FWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYT---QSDKDYYDVSLVDGF 126
Query  128  NIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGP-GSCGP 186
            NIPL  +PT   C    C A I   CPSEL+  GGCN+ C V+ T++YCC N    +C  
Sbjct  127  NIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPA 186
Query  187  TPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226
            T  S+ FK +CP AYSY +DD T+ F C +GT+Y +VFCP
Sbjct  187  TNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYSIVFCP 225

Sequence Alignment: 10. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 183.8 bits 822,  Expect = 4e-48
 Identities = 114/214 53%, Positives = 143/214 66%, Gaps = 6/214 2%
Query  9    LLVSLWAITFFAYTHAAT-FDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQAR 67
            LLV+  AI++      A  FDI NQC YTVWAA  PGGG+RLDQGQ+W +N+A GT  AR
Sbjct  10   LLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASAR 69
Query  68   IWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGF 127
             WGRT C FDA+G+G C +GDC G L C   G  P TLAE+     ++ D+ D+S VDGF
Sbjct  70   FWGRTGCTFDASGKGSCRSGDCGGQLSCTVSGAVPATLAEYT---QSDQDYYDVSLVDGF 126
Query  128  NIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGP-GSCGP 186
            NIPL  +PT   C    C A I   CPSEL+  GGCN+ C V+ T++YCC N    +C  
Sbjct  127  NIPLAINPTNTKCTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPA 186
Query  187  TPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226
            T  S+ FK +CP AYSY +DD T+ F C +GT+Y +VFCP
Sbjct  187  TNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYSIVFCP 225

Sequence Alignment: 11. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 179.1 bits 800,  Expect = 9e-47
 Identities = 106/196 54%, Positives = 133/196 67%, Gaps = 5/196 2%
Query  27   FDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQCET 86
            FDI NQC YTVWAA  PGGG+ +DQGQ+W +N+A GT  AR WGRT C FDA+G+G C +
Sbjct  3    FDIKNQCGYTVWAAGLPGGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRS 62
Query  87   GDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPLEFSPTTNVCRRLVCN 146
            GDC G L C   G  P TLAE+     ++ D+ D+S VDGFNIPL  +PT   C    C 
Sbjct  63   GDCGGQLSCTVSGAVPATLAEYT---QSDQDYYDVSLVDGFNIPLAINPTNTKCTAPACK 119
Query  147  APIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGP-GSCGPTPLSRFFKERCPDAYSYPQ 205
            A I   CPSEL+  GGCN+ C V+ T++YCC N    +C  T  S+ FK +CP AYSY +
Sbjct  120  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVNNCPATNYSKIFKNQCPQAYSYAK 179
Query  206  DDPTSLFTCPAGTNYRVVFCP 226
            DD T+ F C +GT+Y +VFCP
Sbjct  180  DD-TATFACASGTDYSIVFCP 199

Sequence Alignment: 12. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 94.6 bits 404,  Expect = 1e-21
 Identities = 53/85 62%, Positives = 61/85 71%, Gaps = 0/85 0%
Query  24   AATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQ 83
            A  FDI NQC YTVWAA  PGGG+RLDQGQ+W +N+A GT  AR WGRT C FDA+G+G 
Sbjct  6    AVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGS 65
Query  84   CETGDCNGLLECQGYGRPPNTLAEF 108
            C+TGDC   L C   G  P TLAE+
Sbjct  66   CQTGDCGRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 13. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 94.6 bits 404,  Expect = 1e-21
 Identities = 53/85 62%, Positives = 61/85 71%, Gaps = 0/85 0%
Query  24   AATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQ 83
            A  FDI NQC YTVWAA  PGGG+RLDQGQ+W +N+A GT  AR WGRT C FDA+G+G 
Sbjct  6    AVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGS 65
Query  84   CETGDCNGLLECQGYGRPPNTLAEF 108
            C+TGDC   L C   G  P TLAE+
Sbjct  66   CQTGDCGRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 14. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 69.2 bits 287,  Expect = 1e-13
 Identities = 93/225 41%, Positives = 122/225 54%, Gaps = 22/225 9%
Query  1    MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGG--------GRRLDQG 52
            M  S+   LL    AI FF+  HAA     N C  TVW     G         G  L   
Sbjct  1    MMKSQVASLLGLTLAILFFSGAHAAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASK 60
Query  53   QSWNINVAPGTTQARIWGRTNCNFDANGRGQCETGDC-NGLLECQGYGR-PPNTLAEFAL 110
             S +++ AP     R WGRT C+ DA G+  CET DC +G + C G G  PP TL E  +
Sbjct  61   ASRSVD-APSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITI 119
Query  111  NQPNNLDFVDISNVDGFNIPLEFSPT--TNVCRRLVCNAPIVQQCPSELRTPGG------ 162
                  D+ D+S VDGFN+P+  +P   T  C+   C A + + CP+ L+          
Sbjct  120  AANGGQDYYDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVIS 179
Query  163  CNNPCTVFNTNEYCCT---NGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTN 219
            C + C  F  ++YCCT   N P +C PT  S  F+++CP AYSY  DD  S FTC  G +
Sbjct  180  CKSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPD 239
Query  220  YRVVFCP 226
            Y + FCP
Sbjct  240  YVITFCP 246

Sequence Alignment: 15. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 64.3 bits 264,  Expect = 4e-12
 Identities = 95/225 42%, Positives = 130/225 57%, Gaps = 22/225 9%
Query  1    MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGG--------GRRLDQG 52
            M  S+   L ++  AI FF+  HAA     N+C+YTVW     G         G +L  G
Sbjct  1    MMKSQAALLGLTTLAILFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFKLATG 60
Query  53   QSWNINVAPGTTQARIWGRTNCNFDANGRGQCETGDC-NGLLECQGYGR-PPNTLAEFAL 110
             S +++ AP     R +GRT C+ DA+G+  C T DC +G + C G G  PP TL E  +
Sbjct  61   ISRSVD-APSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITI 119
Query  111  NQPNNLDFVDISNVDGFNIPLEFSPT--TNVCRRLVCNAPIVQQCPSELRTPGG------ 162
                  DF D+S VDGFN+P+  +P   T  C+   C A I + CP+ L+  G       
Sbjct  120  ASNGGQDFYDVSLVDGFNLPMSVAPQGGTGKCKASTCPADINKVCPAPLQVKGSDGSVIA 179
Query  163  CNNPCTVFNTNEYCCT---NGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTN 219
            C + C  FN  +YCCT   + P +C PT  S++FK +CP AYSY  DD +S FTC    +
Sbjct  180  CKSACLAFNQPKYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPD 239
Query  220  YRVVFCP 226
            Y + FCP
Sbjct  240  YLITFCP 246

Sequence Alignment: 16. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 61.3 bits 250,  Expect = 3e-11
 Identities = 97/221 43%, Positives = 120/221 54%, Gaps = 23/221 10%
Query  5    KNLPLLVSL-WAITFFAYTHAATFDIVNQCTYTVWAAA-----SPG---GGRRLDQGQSW 55
            K L +++SL   I  F   HAAT    N C Y VW         P     G  L    S+
Sbjct  3    KTLVVVLSLSLTILSFGGAHAATISFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQASF 62
Query  56   NINVAPGTTQARIWGRTNCNFDANGRGQCETGDC-NGLLECQGYGR-PPNTLAEFALNQP 113
             ++  P     R W RT C+ DA+G+  C T DC +G + C G G  PP TLAEF +   
Sbjct  63   QLDT-PVPWNGRFWARTGCSTDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAG 121
Query  114  NNLDFVDISNVDGFNIPLEFSPT--TNVCRRLVCNAPIVQQCPSELRTPGG------CNN 165
               DF D+S VDGFN+P+  +P   T  C+   C A +   CPSEL+  G       C +
Sbjct  122  GGQDFYDVSLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQKKGSDGSVVACLS 181
Query  166  PCTVFNTNEYCCT---NGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRV 222
             C  F T +YCCT   N P +C PT  S  F   CPDAYSY  DD    FTC  G NY +
Sbjct  182  ACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYAI 241
Query  223  VFCP 226
             FCP
Sbjct  242  TFCP 245

Sequence Alignment: 17. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 61.1 bits 249,  Expect = 4e-11
 Identities = 95/225 42%, Positives = 131/225 58%, Gaps = 22/225 9%
Query  1    MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGG--------GRRLDQG 52
            M  S+   L ++  AI FF+  HAA     N+C+YTVW     G         G  L  G
Sbjct  1    MMKSQAALLGLTTLAILFFSGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFELATG 60
Query  53   QSWNINVAPGTTQARIWGRTNCNFDANGRGQCETGDC-NGLLECQGYGR-PPNTLAEFAL 110
             S +++ AP     R +GRT C+ DA+G+  C T DC +G + C G G  PP TL E  +
Sbjct  61   ISNSVD-APSPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAVPPATLVEITI 119
Query  111  NQPNNLDFVDISNVDGFNIPLEFSPT--TNVCRRLVCNAPIVQQCPSELRTPGG------ 162
             +    DF D+S VDGFN+P+  +P   T  C+   C A I + CP+EL+  G       
Sbjct  120  AENGGQDFYDVSLVDGFNLPMSVAPQGGTGECKASTCPADINKVCPAELQVKGSDGSVIA 179
Query  163  CNNPCTVFNTNEYCCT---NGPGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTN 219
            C + C  +N  +YCCT   + P +C PT  S++FK +CP AYSY  DD +S FTC    +
Sbjct  180  CKSACLALNQPQYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPD 239
Query  220  YRVVFCP 226
            Y + FCP
Sbjct  240  YLITFCP 246

Sequence Alignment: 18. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 59.8 bits 243,  Expect = 9e-11
 Identities = 99/220 45%, Positives = 130/220 59%, Gaps = 22/220 10%
Query  5    KNLPLLVSLWAITFFAY--THAATFDIVNQCTYTVWAAA--SPG---GGRRLDQGQSWNI 57
            K L  ++SL ++T++++   HAAT    N C YTVW A+  +P     G  L    S+ +
Sbjct  3    KTLVAVLSL-SLTLLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQL 61
Query  58   NVAPGTTQARIWGRTNCNFDANGRGQCETGDCN-GLLECQGY-GRPPNTLAEFALNQPNN 115
            +  P     R W RT C+ DA+G+  CET DC+ G L C G  G PP TLAEF +     
Sbjct  62   DT-PVPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGG 120
Query  116  LDFVDISNVDGFNIPLEFSPT--TNVCRRLVCNAPIVQQCPSELRTPGG------CNNPC 167
             DF D+S VDGFN+P+  +P   T  C+   C A +   CPSEL+  G       C + C
Sbjct  121  QDFYDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSAC 180
Query  168  TVFNTNEYCCTNGPGS---CGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVF 224
              F   +YCCT    +   C PT  S+ F E+CPDAYSY  DD   LFTC  G NY + F
Sbjct  181  VKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITF 240
Query  225  CP 226
            CP
Sbjct  241  CP 242

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.