The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MNTTTMAFKLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPF
QISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKT
KRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWGLTDGN
TQDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVYNGKL
AGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANKV
Sequence Info Allergen Name Length Opt Bits Score E Value
AAQ24544 Blo t 6.0101 275 1849 428.1 1.7e-121
P49276 Der f 6 279 1059 248.0 2.8e-67
AAP57077 Der p 9.0101 273 594 142.0 2.2e-35
AAM10779 Blo t 3.0101 266 565 135.4 2.1e-33
AAN02511 Der p 9.0102 261 528 127.0 7e-31
O97370 Eur m 3 261 502 121.1 4.2e-29
P49275 Der f 3 259 490 118.3 2.8e-28
P39675 Der p 3 261 488 117.9 3.9e-28
ABZ81991 Tyr p 3.0101 285 403 98.5 2.9e-22
P09582 Can f 5.0101 260 370 91.0 4.8e-20
AAP37412 Pol d 4.0101 277 232 59.5 1.5e-10
Q7M4I3 Bom p 4.0101 243 222 57.3 6.3e-10
AAN02286 Api m 7 405 186 48.9 3.5e-07
3989146 Pol e 4.0101 241 124 34.9 0.0033
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 6.0101 Sequence ID: AAQ24544

 Score = 428.1 bits 1849,  Expect = 2e-121
 Identities = 275/275 100%, Positives = 275/275 100%, Gaps = 0/275 0%
Query  1    MNTTTMAFKLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPF 60
            MNTTTMAFKLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPF
Sbjct  1    MNTTTMAFKLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPF 60
Query  61   QISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKT 120
            QISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKT
Sbjct  61   QISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKT 120
Query  121  KRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWGLTDGN 180
            KRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWGLTDGN
Sbjct  121  KRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWGLTDGN 180
Query  181  TQDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVYNGKL 240
            TQDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVYNGKL
Sbjct  181  TQDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVYNGKL 240
Query  241  AGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANKV 275
            AGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANKV
Sbjct  241  AGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANKV 275

Sequence Alignment: 2. Allergen Name: Der f 6 Sequence ID: P49276

 Score = 248.0 bits 1059,  Expect = 3e-67
 Identities = 153/268 57%, Positives = 195/268 72%, Gaps = 7/268 2%
Query  8    FKLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSR----NSP--RVVGGTDAKKAEAPFQ 61
            F + +++ +   V ARFP+++Q +W YLD+ E+ R    +SP   VVGG DA  AEAPFQ
Sbjct  5    FLVTILIVITVTVDARFPRSLQPKWAYLDSNEFPRSKIGDSPIAGVVGGQDADLAEAPFQ 64
Query  62   ISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKTK 121
            ISL+KDYLI+K H+CGGSLI+  TVVTAAHCT GQ ASSL  R GTNQR+     D+K K
Sbjct  65   ISLLKDYLIMKRHMCGGSLISESTVVTAAHCTYGQKASSLSVRYGTNQRTSSSYGDLKVK 124
Query  122  RIVQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWGLTDGNT 181
             I+QHE Y+ +  + D +++IL +P+ PS  V++  IE  ++  G+ V +YGWGLTDGN 
Sbjct  125  PIIQHESYEQDQTQTDKTIIILPNPVVPSTNVQMNEIETEDIVDGDKVTIYGWGLTDGNG 184
Query  182  QDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVY-NGKL 240
            +DLP+ LQ G + IV  + CN KWG +N I PGMICAL  +   CNGDSGGPLV  N KL
Sbjct  185  KDLPDKLQKGSMTIVGNDRCNEKWGSINAIHPGMICALDKTQSGCNGDSGGPLVSANRKL 244
Query  241  AGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANKV 275
             GIVSWGPSKCP GEYM+VFTRP +YL+WI  N V
Sbjct  245  TGIVSWGPSKCPPGEYMSVFTRPKYYLDWITKNIV 279

Sequence Alignment: 3. Allergen Name: Der p 9.0101 Sequence ID: AAP57077

 Score = 142.0 bits 594,  Expect = 2e-35
 Identities = 92/251 36%, Positives = 144/251 57%, Gaps = 7/251 2%
Query  19   AVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPFQISLMKDYLILKSHICGG 78
            A+   +P AI +++ ++     +    R+VGG++A   +A +QI+L +      S  CGG
Sbjct  22   AIRLPLPDAITEKFPWMINEPLNDERERIVGGSNASPGDAVYQIALFRK----DSFTCGG 77
Query  79   SLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDI 138
            SLI+ +TV+TAAHC  G  A+    ++  N   +   P I   +I +H  Y  + I+ D+
Sbjct  78   SLISSRTVLTAAHCVFGDEATPSYFKIRYNTLDRTNGPPIGVSKIYRHNLYSSSPIDYDV 137
Query  139  SLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWG-LTDGNTQDLPENLQVGELKIVS 197
            + LIL+ P TPS    +I +  +    G  +++ GWG L  G T  LP  LQ+  +  +S
Sbjct  138  ATLILSQPFTPSANADIIPLTTSEPADGTKLQITGWGRLKSGGT--LPTILQIASVTKMS 195
Query  198  QEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVYNGKLAGIVSWGPSKCPVGEYM 257
            + +C++ WG VN I   M+CA   +  +CNGDSGGPLV NG L G+VSWGPS C   +Y 
Sbjct  196  RTKCSSTWGSVNAITNRMLCAHNSNQASCNGDSGGPLVSNGHLVGVVSWGPSTCLSTKYP 255
Query  258  AVFTRPNHYLEWINANKV 275
             +++   +   WI +N V
Sbjct  256  TIYSNVANLRNWIISNTV 273

Sequence Alignment: 4. Allergen Name: Blo t 3.0101 Sequence ID: AAM10779

 Score = 135.4 bits 565,  Expect = 2e-33
 Identities = 101/253 39%, Positives = 143/253 56%, Gaps = 19/253 7%
Query  13   VLALFCAVHARFPKAIQDRWG--YLDTYEYSRNSPRVVGGTDAKKAEAPFQISLMKDYLI 70
            VL LFC V       ++D      +D + Y+     +VGG++A   +AP+Q+SL +    
Sbjct  3    VLVLFCLVSLAAAGPLKDALNKAQVDAF-YAEG--YIVGGSNAADGDAPYQVSLQRT--- 56
Query  71   LKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKTKRIVQHEQYD 130
              SH CGGS+I    ++TAAHC  G +ASSL  R  T + +  G+  +K  RI+ HE+YD
Sbjct  57   --SHFCGGSIIADNYILTAAHCIQGLSASSLTTRYNTLRHNSGGLT-VKASRIIGHEKYD 113
Query  131  PNTIENDISLLILASPITPSDT-VKVIAIEE--TNLNGGEDVKLYGWGLTDGNTQDLPEN 187
             NTI+NDI+L+  AS ++   T  + I + E  ++     +V + GWG        LP  
Sbjct  114  SNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPKASSEVLITGWGTLSSGASSLPTK 173
Query  188  LQVGELKIVSQEECNAKWGEVNT-IKPGMICAL---APSTQACNGDSGGPLVYNGKLAGI 243
            LQ   + IV ++ CNA +G V   I   M CA         AC GDSGGP+  NG L G 
Sbjct  174  LQKVTVPIVDRKTCNANYGAVGAEITDNMFCAGILNVGGKDACQGDSGGPVAANGVLVGA 233
Query  244  VSWGPSKCPVGEYMAVFTRPNHYLEWINANKV 275
            VSWG   C   +Y  V+TR  +Y+ WI    V
Sbjct  234  VSWGYG-CAQAKYPGVYTRVGNYISWIKGKGV 264

Sequence Alignment: 5. Allergen Name: Der p 9.0102 Sequence ID: AAN02511

 Score = 127.0 bits 528,  Expect = 7e-31
 Identities = 85/224 37%, Positives = 129/224 57%, Gaps = 8/224 3%
Query  19   AVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPFQISLMKDYLILKSHICGG 78
            A+   +P AI +++ ++     +    R+VGG++A   +A +QI+L +      S  CGG
Sbjct  36   AIRLPLPDAITEKFPWMINEPLNDERERIVGGSNASPGDAVYQIALFRK----DSFTCGG 91
Query  79   SLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDI 138
            SLI+ +TV+TAAHC  G  A+    ++  N   +   P I   +I +H  Y  +TI+ D+
Sbjct  92   SLISSRTVLTAAHCVFGDEATPSYFKIRYNTLDRTNGPTIGVSKIYRHNLYSSSTIDYDV 151
Query  139  SLLILASPITPSDTVKVIAIEETNLNGGEDVKLYGWG-LTDGNTQDLPENLQVGELKIVS 197
            + LIL+ P TPS    +I +  +    G  +++ GWG L  G T  LP  LQ+  +  +S
Sbjct  152  ATLILSQPFTPSANADIIPLTTSEPADGTKLQITGWGRLKSGGT--LPTILQIASVTKMS 209
Query  198  QEECNAKWGEVNTIKPGMICALAPSTQACNGDSGGPLVYNGKLAG-IVSWGP 248
            + +C++ WG VN I   M+CA      +CNGDSGGPLV NG L G   SWGP
Sbjct  210  RTKCSSTWGSVNAITNRMLCAHNSKQASCNGDSGGPLVSNGHLVGGKFSWGP 261

Sequence Alignment: 6. Allergen Name: Eur m 3 Sequence ID: O97370

 Score = 121.1 bits 502,  Expect = 4e-29
 Identities = 88/225 39%, Positives = 138/225 61%, Gaps = 18/225 8%
Query  43   NSPR--VVGGTDAKKAEAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASS 100
            +SP   +VGG  AK  E P+QISL        SH CGG+++    ++TAAHC +GQTAS 
Sbjct  24   SSPNATIVGGQKAKAGECPYQISLQS-----SSHFCGGTILDEYWILTAAHCVNGQTASK 78
Query  101  LINRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPIT-PSDTVKVIAI- 158
            L  R  + + +  G   +   +I QHE+YD  TI+NDI+L+ L SP+T      K + + 
Sbjct  79   LSIRYNSLKHASGG-EKLSVAQIYQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLP 137
Query  159  -EETNLNGGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVN-TIKPGMI 216
             + +++  G+ V++ GWG     +  LP ++   ++ IV++E+CN  + E   TI   MI
Sbjct  138  SQGSDVKVGDKVRVSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMI 197
Query  217  CA--LAPS-TQACNGDSGGPLV--YNGKLAGIVSWGPSKCPVGEYMAVFTRPNHYLEWIN 271
            C   +A     +C GDSGGP+V   + ++ GIVSWG   C    Y  V+TR   +++WI+
Sbjct  198  CGGNVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYG-CARKGYPGVYTRVGSFIDWID 256
Query  272  ANK 274
            + +
Sbjct  257  SKR 259

Sequence Alignment: 7. Allergen Name: Der f 3 Sequence ID: P49275

 Score = 118.3 bits 490,  Expect = 3e-28
 Identities = 82/225 36%, Positives = 133/225 59%, Gaps = 18/225 8%
Query  43   NSPR--VVGGTDAKKAEAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASS 100
            +SP   +VGG  A+  + P+QISL        SH CGGS++    ++TAAHC +GQ+A  
Sbjct  22   SSPNATIVGGVKAQAGDCPYQISLQS-----SSHFCGGSILDEYWILTAAHCVNGQSAKK 76
Query  101  LINRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPITPSDT-VKVIAI- 158
            L  R  T + +  G   I+   I QHE YD  TI+ND++L+ L +P+T   T  K + + 
Sbjct  77   LSIRYNTLKHASGG-EKIQVAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLP 135
Query  159  -EETNLNGGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVNT-IKPGMI 216
             + +++  G+ +++ GWG     +  LP  LQ  ++ +VS+E+C+  + +    +   MI
Sbjct  136  AQGSDVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMI 195
Query  217  CA---LAPSTQACNGDSGGPLV--YNGKLAGIVSWGPSKCPVGEYMAVFTRPNHYLEWIN 271
            C          +C GDSGGP+V     ++ GIVSWG   C    Y  V+TR  ++++WI 
Sbjct  196  CGGDVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYG-CARKGYPGVYTRVGNFVDWIE 254
Query  272  ANK 274
            + +
Sbjct  255  SKR 257

Sequence Alignment: 8. Allergen Name: Der p 3 Sequence ID: P39675

 Score = 117.9 bits 488,  Expect = 4e-28
 Identities = 84/221 38%, Positives = 132/221 59%, Gaps = 16/221 7%
Query  47   VVGGTDAKKAEAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLG 106
            +VGG  A   E P+QISL        SH CGG+++    ++TAAHC  GQTAS L  R  
Sbjct  30   IVGGEKALAGECPYQISLQSS-----SHFCGGTILDEYWILTAAHCVAGQTASKLSIRYN 84
Query  107  TNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPITPSD-TVKVIAIEE--TNL 163
            + + S  G   I   +I  HE+YD   I+NDI+L+ L SP+  +    K + +    +++
Sbjct  85   SLKHSLGG-EKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDV 143
Query  164  NGGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVNT-IKPGMICA--LA 220
              G+ V++ GWG  +  +  LP  L+  ++ +VS++ECN  + + N  +   MIC   +A
Sbjct  144  KVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVA 203
Query  221  PSTQ-ACNGDSGGPLV--YNGKLAGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANK 274
               + +C GDSGGP+V   N ++ GIVSWG   C    Y  V+TR  ++++WI + +
Sbjct  204  NGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYG-CARKGYPGVYTRVGNFIDWIESKR 259

Sequence Alignment: 9. Allergen Name: Tyr p 3.0101 Sequence ID: ABZ81991

 Score = 98.5 bits 403,  Expect = 3e-22
 Identities = 92/246 37%, Positives = 134/246 54%, Gaps = 26/246 10%
Query  9    KLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKAEAPFQISLMKDY 68
            K++L L ++ +V    P  IQ     L +   S+N   +VGGT+A   +AP Q+SL    
Sbjct  2    KILLFLCFLVSVAFAKPPTIQ-----LKSNTKSQNG-FIVGGTEAVDGDAPHQVSLQHT- 54
Query  69   LILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRS-----KPGIPDIKTKRI 123
                SH CGGS+I+ + ++TAAHC D   A  L N  G + R      K G   +K K I
Sbjct  55   ----SHFCGGSIISERWILTAAHCID---ADDLSNPGGMSVRYNTLNLKSGTL-VKVKSI 106
Query  124  VQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLNGGEDVKLY--GWGLTDGNT 181
              HEQY   T +NDI+LL   + +  + T  V A      N  +D  L+  GWG      
Sbjct  107  KVHEQYSNVTSDNDIALLETVASMNLNQTNAVAAKLPAKGNDPQDGDLFLSGWGTLHSGD 166
Query  182  QDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALA---PSTQACNGDSGGPLVYNG 238
              +P NLQ   + + ++  C   +  +  I   M CA         +C GDSGG  + N 
Sbjct  167  TTIPTNLQKVTVPLTNRSVCAEAYTGIVNITENMFCAGKMGIGGVDSCQGDSGGGAMLNK 226
Query  239  KLAGIVSWGPSKCPVGEYMAVFTRPNHYLEWI 270
            +L G+VS+G   C   +Y  V+TR ++YL+WI
Sbjct  227  ELVGVVSFGVG-CGDPKYPGVYTRVSQYLDWI 257

Sequence Alignment: 10. Allergen Name: Can f 5.0101 Sequence ID: P09582

 Score = 91.0 bits 370,  Expect = 5e-20
 Identities = 70/218 32%, Positives = 115/218 52%, Gaps = 20/218 9%
Query  45   PRVVGGTDAKKAEAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINR 104
            PR++GG +  K   P+Q+++  +        CGG L+ P+ V+TAAHC +      L  R
Sbjct  23   PRIIGGRECLKNSQPWQVAVYHN----GEFACGGVLVNPEWVLTAAHCANSNCEVWL-GR 77
Query  105  LGTNQRSKPGIPDIKTKRIVQHEQYD---PNTI-------ENDISLLILASPITPSDTVK 154
               ++    G   ++ ++   H  Y    P  +        +D+ LL L  P   +  V+
Sbjct  78   HNLSESEDEG-QLVQVRKSFIHPLYKTKVPRAVIRPGEDRSHDLMLLHLEEPAKITKAVR 136
Query  155  VIAIEETNLNGGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVNTIKPG 214
            V+ + +     G    + GWG TD  T   P +LQ  +LK++S  +C   + +   +   
Sbjct  137  VMDLPKKEPPLGSTCYVSGWGSTDPETIFHPGSLQCVDLKLLSNNQCAKVYTQ--KVTKF 194
Query  215  MICA--LAPSTQACNGDSGGPLVYNGKLAGIVSWGPSKCPVGEYMAVFTRPNHYLEWI 270
            M+CA  L      C GDSGGPL+ +G+L GI SWG + C   +  +++TR   +L WI
Sbjct  195  MLCAGVLEGKKDTCKGDSGGPLICDGELVGITSWGATPCGKPQMPSLYTRVMPHLMWI 252

Sequence Alignment: 11. Allergen Name: Pol d 4.0101 Sequence ID: AAP37412

 Score = 59.5 bits 232,  Expect = 2e-10
 Identities = 58/198 29%, Positives = 100/198 50%, Gaps = 23/198 11%
Query  43   NSPRVVGGTDAKKAEAPFQISLMKDYLILKS--HICGGSLITPQTVVTAAHCTDG--QTA 98
            N  R+V G + +  E P     M   LI  S    CGG++ITPQ +VTAAHC     +T 
Sbjct  30   NPSRIVNGVETEINEFP-----MVARLIYPSPGMYCGGTIITPQHIVTAAHCLQKYKRTN 84
Query  99   SSLINRL-GTNQRSKPGIPDIKTKRIVQHEQYDPN--TIENDISLLILASPITPSDTVKV 155
             + I+ + G +  +     ++  +  +      PN  +  NDI+++        S  V  
Sbjct  85   YTGIHVVVGEHDYTTDTETNVTKRYTIAEVTIHPNYNSHNNDIAIVKTNERFEYSMKVGP 144
Query  156  IAIEETNLN---GGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVNTIK 212
            + +    +      E V   GWG    N Q+  + L+  +L ++++E+C   +G      
Sbjct  145  VCLPFNYMTRNLTNETVTALGWGKLRYNGQN-SKVLRKVDLHVITREQCETHYGAA-IAN 202
Query  213  PGMICALAPSTQACNGDSGGPLVY------NGKLAGIVSWG 247
              ++C +     AC  DSGGP+++      N  L G+V++G
Sbjct  203  ANLLCTFDVGRDACQNDSGGPILWRSPTTDNLILVGVVNFG 243

Sequence Alignment: 12. Allergen Name: Bom p 4.0101 Sequence ID: Q7M4I3

 Score = 57.3 bits 222,  Expect = 6e-10
 Identities = 72/213 33%, Positives = 116/213 54%, Gaps = 30/213 14%
Query  47   VVGGTDAKKAEAPFQISL-MKDYLILKSHI---CGGSLITPQTVVTAAHCTDGQTASSL- 101
            VVGG  AK    P+ ++L   +Y   K      CGGSL   + V+TAAHC   ++   + 
Sbjct  1    VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVR 60
Query  102  ---INRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIA- 157
               +N    +  + P    I++K I  H  Y  +   +DI++L L   ++ S+ ++ I  
Sbjct  61   IADLNLKRDDDGAHPIQMGIESKLI--HPDYVYSEHHDDIAILKLEKDVSFSEYIRPICL 118
Query  158  -IEETNLNG---GEDVKLYGWGLT--DGNTQDLPENLQVGELKIVSQEECNAKWGEVNTI 211
             IEE+  N    G +  + GWG     G   D    +QV    +V  + C   + +V+  
Sbjct  119  PIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQV---PVVRNKVCKRAYSDVSDT 175
Query  212  KPGMICALAPSTQ--ACNGDSGGPLVYNGKLA----GIVSWGPSKCPVGEYMAVFTRPNH 265
               +ICA  P  +  +C GDSGGPL+   +      G+VS+G  +C + +Y  V+TR   
Sbjct  176  ---VICAGYPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYG-HECALPKYPGVYTRVTS 231
Query  266  YLE 268
            YL+
Sbjct  232  YLD 234

Sequence Alignment: 13. Allergen Name: Api m 7 Sequence ID: AAN02286

 Score = 48.9 bits 186,  Expect = 3e-07
 Identities = 83/254 32%, Positives = 134/254 52%, Gaps = 39/254 15%
Query  1    MNTTTMAFKLVLVLA----LFCAVHARFPKAIQDRWGYLDTYEYSRNSPRVVGGTDAKKA 56
            +N  + + K+ ++L     +FC V  R  K ++D     +     +N  R+VGGT+    
Sbjct  116  LNIESTSNKMTVILTPPGRFFCEV--RPIKRVKDS---TNCNCGWKNPSRIVGGTNTGIN 170
Query  57   EAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTASSLINRLGTNQRSKPGIP 116
            E P    + + Y      ICG ++I+ + V+TAAHC   +  + L   +G +  S     
Sbjct  171  EFPMMAGIKRTYE--PGMICGATIISKRYVLTAAHCIIDENTTKLAIVVGEHDWSSKTET 228
Query  117  DIKT----KRIVQHEQYDPNTIE------NDISLLILASPITPSDTVKVIAIEETNLN-- 164
            +        +++ H +YD   IE      NDI+LL     I   D V    +   ++   
Sbjct  229  NATVLHSINKVIIHPKYD--IIEKDDWQINDIALLKTEKDIKFGDKVGPACLPFQHFLDS 286
Query  165  -GGEDVKLYGWGLTDGNTQDLPENLQVGELKIVSQEECNAKWGEVNTIKPGMICALAPST 223
              G DV + GWG T  N   L   LQ   L +++Q EC   +G +       +CA A   
Sbjct  287  FAGSDVTVLGWGHTSFNGM-LSHILQKTTLNMLTQVECYKYYGNIMV---NAMCAYAKGK 342
Query  224  QACNGDSGGPLVYNG----KLA--GIVSWGPSKCPVGEYMAVFTRPNHYLEWI 270
             AC  DSGGP+++      +L   GI+SWG ++C  G+Y    T+   Y++WI
Sbjct  343  DACQMDSGGPVLWQNPRTKRLVNIGIISWG-AEC--GKYPNGNTKVGSYIDWI 392

Sequence Alignment: 14. Allergen Name: Pol e 4.0101 Sequence ID: 3989146

 Score = 34.9 bits 124,  Expect = 0.003
 Identities = 33/123 26%, Positives = 57/123 46%, Gaps = 11/123 8%
Query  47   VVGGTDAKKAEAPFQISLMKDYLILKSHICGGSLITP--QTVVTAAHCTDGQTASSLINR 104
            +V G +    E P    L+     +    CGG++ITP  + ++TAAHC +G    +L   
Sbjct  1    LVNGVETGINEFPMMARLIYXXXXF---YCGGTIITPPFKHILTAAHCVEGFLDPTLXXX 57
Query  105  LGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPITPSDTVKVIAIEETNLN 164
              T   +   +    T ++  H  Y  +  +NDIS+++          V  + +    +N
Sbjct  58   XSTTGETYD-LSXXYTIKVTIHPNYFDH--DNDISIVLXXXXXXXXXXVGPVCLPFNYMN 114
Query  165  GG-EDVKL--YGWG 175
                DV +   GWG
Sbjct  115  RVFTDVTVTALGWG 128

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.