The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MPGDPTATAKGNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAY
TPICHQQHIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLA
FSKALGATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV
Sequence Info Allergen Name Length Opt Bits Score E Value
P56577 Mala f 2 177 1180 276.0 4.2e-76
CAA09883 Mala s 5 172 707 168.2 1.2e-43
P56578 Mala f 3 166 617 147.7 1.7e-37
O43099 Asp f 3 168 443 108.0 1.5e-25
AAD42074 Pen c 3 167 413 101.2 1.7e-23
AAA34358 Cand b 2 167 384 94.6 1.6e-21
AAA34357 Cand b 2 167 382 94.1 2.2e-21
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mala f 2 Sequence ID: P56577

 Score = 276.0 bits 1180,  Expect = 4e-76
 Identities = 177/177 100%, Positives = 177/177 100%, Gaps = 0/177 0%
Query  1    MPGDPTATAKGNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAY 60
            MPGDPTATAKGNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAY
Sbjct  1    MPGDPTATAKGNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAY 60
Query  61   TPICHQQHIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLA 120
            TPICHQQHIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLA
Sbjct  61   TPICHQQHIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLA 120
Query  121  FSKALGATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177
            FSKALGATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV
Sbjct  121  FSKALGATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177

Sequence Alignment: 2. Allergen Name: Mala s 5 Sequence ID: CAA09883

 Score = 168.2 bits 707,  Expect = 1e-43
 Identities = 97/167 58%, Positives = 127/167 76%, Gaps = 0/167 0%
Query  11   GNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQHIP 70
            G++ P+T   YIPW PELDSG+VCG+P TFK  D WKGKKVV+V+IPGA+TP CHQ HIP
Sbjct  6    GSQAPNTTFTYIPWAPELDSGKVCGVPQTFKAHDRWKGKKVVVVAIPGAFTPACHQNHIP 65
Query  71   PLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLAFSKALGATID 130
             +V++++ELKAKGVD V VIA ND FVM+ WG     KD++V+A D DLAFSKALG T+D
Sbjct  66   GFVEKINELKAKGVDEVVVIAVNDAFVMSGWGVTVGGKDQIVYACDNDLAFSKALGGTLD 125
Query  131  LSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177
            L++   G RTARYA+++DD KI  F  DEG+ G  + +S+D +L ++
Sbjct  126  LTSGGMGVRTARYAVVLDDLKITYFGMDEGNMGAPEKSSVDAVLAQL 172

Sequence Alignment: 3. Allergen Name: Mala f 3 Sequence ID: P56578

 Score = 147.7 bits 617,  Expect = 2e-37
 Identities = 85/164 51%, Positives = 124/164 75%, Gaps = 3/164 1%
Query  11   GNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQHIP 70
            G+ IP+    Y+P++PEL+  +VCG+PT+F++ + WKGKKVVIV++PGA+TP C   H+P
Sbjct  3    GSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHVP 62
Query  71   PLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLAFSKALGATID 130
            P V+++ ELK+KGVD V VI++NDPFV++AWG   +AKD + FA D++  FSK + AT+D
Sbjct  63   PYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNATLD 122
Query  131  LSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177
            LS+K  G RTARYALI +D K+  F  DEG+    + +S  T+L+K+
Sbjct  123  LSSKGMGLRTARYALIANDLKVEYFGIDEGEP---KQSSAATVLSKL 166

Sequence Alignment: 4. Allergen Name: Asp f 3 Sequence ID: O43099

 Score = 108.0 bits 443,  Expect = 1e-25
 Identities = 70/155 45%, Positives = 104/155 67%, Gaps = 13/155 8%
Query  11   GNEIP-DTLMGYIPWTPELDSGEV--CGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQ 67
            G+  P D +  YIPW+   D GE+  CGIP  +    EW  KKV++ ++PGA+TP+C  +
Sbjct  7    GDSFPSDVVFSYIPWSE--DKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSAR 64
Query  68   HIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAK-DKVVFATDIDLAFSKALG 126
            H+P  ++++ E++AKGVD V V+A ND +VM+AWG  N    D ++F +D D  FSK++G
Sbjct  65   HVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIG 124
Query  127  ATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTIL 174
                  A   G RT RYAL+ID  KI  +A+ E     L+ +S +T+L
Sbjct  125  W-----ADEEG-RTKRYALVIDHGKIT-YAALEPAKNHLEFSSAETVL 165

Sequence Alignment: 5. Allergen Name: Pen c 3 Sequence ID: AAD42074

 Score = 101.2 bits 413,  Expect = 2e-23
 Identities = 64/160 40%, Positives = 100/160 62%, Gaps = 9/160 5%
Query  11   GNEIPDTL-MGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQHI 69
            G+  P+ +   YIPW  +      CGIP  +    E+  KKVV+ ++PGA+TP+C   H+
Sbjct  6    GDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSANHV 65
Query  70   PPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAK-DKVVFATDIDLAFSKALGAT 128
            P  ++++ EL+AKGVD V V+A ND +VM+AWG  N    D ++F +D +  FSK++G  
Sbjct  66   PEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSKSIGW- 124
Query  129  IDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177
                A   G RT RY L+ID+ KI+ +A+ E     L+ +  D +L ++
Sbjct  125  ----ADEEG-RTYRYVLVIDNGKII-YAAKEAAKNSLELSRADHVLKQL 167

Sequence Alignment: 6. Allergen Name: Cand b 2 Sequence ID: AAA34358

 Score = 94.6 bits 384,  Expect = 2e-21
 Identities = 68/159 42%, Positives = 105/159 66%, Gaps = 12/159 7%
Query  10   KGNEIPDTL-MGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQH 68
            +G+  P T  + YIP  PE   GE    P  F+     K KK V+VS+PGA+TP C +QH
Sbjct  6    RGDRFPTTDDVYYIP--PE--GGE----PGAFELSKFVKTKKFVVVSVPGAFTPPCTEQH 57
Query  69   IPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKD--KVVFATDIDLAFSKALG 126
            +P  +K +  + +KGVD V VI  NDPFV+  W     A D  K++F +D +L ++K LG
Sbjct  58   LPGYIKNLPRILSKGVDFVLVITQNDPFVLKGWKKELGAADAKKLIFVSDPNLKLTKKLG 117
Query  127  ATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177
            +TIDLS+  +G R+ R ALI++ + IV++A+ E + G++  ++   I+ K+
Sbjct  118  STIDLSSIGLGTRSGRLALIVNRSGIVEYAAIE-NGGEVDVSTAQKIIAKL 167

Sequence Alignment: 7. Allergen Name: Cand b 2 Sequence ID: AAA34357

 Score = 94.1 bits 382,  Expect = 2e-21
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 12/159 7%
Query  10   KGNEIPDTL-MGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQH 68
            +G+  P T  + YIP  PE   GE    P  ++     K KK V+VS+PGA+TP C +QH
Sbjct  6    RGDRFPTTDDVYYIP--PE--GGE----PGPLELSKFVKTKKFVVVSVPGAFTPPCTEQH 57
Query  69   IPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKD--KVVFATDIDLAFSKALG 126
            +P  +K +  + +KGVD V VI+ NDPFV+  W     A D  K+VF +D +L ++K LG
Sbjct  58   LPGYIKNLPRILSKGVDFVLVISQNDPFVLKGWKKELGAADAKKLVFVSDPNLKLTKKLG 117
Query  127  ATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177
            +TIDLSA  +G R+ R ALI++ + IV++A+ E + G++  ++   I+ K+
Sbjct  118  STIDLSAIGLGTRSGRLALIVNRSGIVEYAAIE-NGGEVDVSTAQKIIAKL 167

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.