The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK
GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK
AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT
EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ
IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF
AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI
NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE
EELGDKRLYAGDNFRTAINL
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA55070 Cla h 6 440 2829 651.2 3e-188
P42040 Cla h 6 440 2796 643.7 5.5e-186
Q9HDT3 Alt a 5 438 2531 583.2 8.4e-168
AAK49451 Asp f 22.0101 438 2429 560.0 8.3e-161
AAK51201 Pen c 22.0101 438 2405 554.5 3.7e-159
AAK67491 Cur l 2.0101 440 2389 550.9 4.7e-158
Q870B9 Rho m 1.0101 439 2147 495.7 1.9e-141
XP_034156632 Pan h 2.0101 434 1758 407.0 9.1e-115
A0A2U9IY94 Cyp c 2.0101 433 1752 405.7 2.3e-114
B5DGQ7 Sal s 2.0101 434 1742 403.4 1.1e-113
A0A1B2H9Q5 Amb a 12.0102 445 1653 383.1 1.5e-107
P07322 Gal d 9.0101 434 1647 381.7 3.8e-107
Q9LEJ0 Hev b 9 445 1640 380.1 1.2e-106
Q9LEI9 Hev b 9 445 1636 379.2 2.2e-106
A0A1B2H9Q1 Amb a 12.0101 431 1568 363.7 9.9e-102
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cla h 6 Sequence ID: CAA55070

 Score = 651.2 bits 2829,  Expect = 3e-188
 Identities = 440/440 100%, Positives = 440/440 100%, Gaps = 0/440 0%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK
Sbjct  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT
Sbjct  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ
Sbjct  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF
Sbjct  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
            AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI
Sbjct  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
            NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE
Sbjct  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
Query  421  EELGDKRLYAGDNFRTAINL 440
            EELGDKRLYAGDNFRTAINL
Sbjct  421  EELGDKRLYAGDNFRTAINL 440

Sequence Alignment: 2. Allergen Name: Cla h 6 Sequence ID: P42040

 Score = 643.7 bits 2796,  Expect = 6e-186
 Identities = 435/440 98%, Positives = 437/440 99%, Gaps = 0/440 0%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPS ASTGSHEACELRDGDKSKWAGK
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWAGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK
Sbjct  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT
Sbjct  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ
Sbjct  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQY +LAAKYPIVSIEDPF
Sbjct  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYKQLAAKYPIVSIEDPF 300
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
            AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI
Sbjct  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
            NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE
Sbjct  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
Query  421  EELGDKRLYAGDNFRTAINL 440
            EELGDK +YAGDNFRTAINL
Sbjct  421  EELGDKAVYAGDNFRTAINL 440

Sequence Alignment: 3. Allergen Name: Alt a 5 Sequence ID: Q9HDT3

 Score = 583.2 bits 2531,  Expect = 8e-168
 Identities = 391/438 89%, Positives = 413/438 94%, Gaps = 2/438 0%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M I+KIH+R VYDSRGNPTVEVDIVTETGLHRAIVPS ASTGSHEACELRDGDKSKW GK
Sbjct  1    MTITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWGGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GVTKAVANVN+ IAPALIKE LDVKDQ+AVDAFLNKLDGTTNKT +GANAILGVSMA+AK
Sbjct  61   GVTKAVANVNDTIAPALIKEKLDVKDQSAVDAFLNKLDGTTNKTNLGANAILGVSMAIAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            AAAAEK VPLYAHISDL+GTKKP+VLPVPF NV+NGGSHAGGRLAFQEFMIVP  AP+F+
Sbjct  121  AAAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPCEAPTFS 180
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EAMRQGAEVYQKLK+L KK YGQSAGNVGDEGGVAPDIQTAEEALDLIT AIEEAGYTG+
Sbjct  181  EAMRQGAEVYQKLKALAKKTYGQSAGNVGDEGGVAPDIQTAEEALDLITKAIEEAGYTGK 240
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKW+TYEQLA+ Y  LA KYPIVSIEDPF
Sbjct  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWLTYEQLAEMYKSLAEKYPIVSIEDPF 300
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
            AEDDWEAWSYF+KT   D QIVGDDLTVTNPEFIKKAIE K+CNALLLKVNQIGTITEAI
Sbjct  301  AEDDWEAWSYFFKT--YDGQIVGDDLTVTNPEFIKKAIELKSCNALLLKVNQIGTITEAI 358
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             AAKD+F AGWGVMVSHRSGETEDVTIADIVVGLR+GQIKTGAPARSERLAKLNQILRIE
Sbjct  359  QAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTGAPARSERLAKLNQILRIE 418
Query  421  EELGDKRLYAGDNFRTAINL 440
            EELGD  +YAG+NFRTA+NL
Sbjct  419  EELGDNAVYAGNNFRTAVNL 438

Sequence Alignment: 4. Allergen Name: Asp f 22.0101 Sequence ID: AAK49451

 Score = 560.0 bits 2429,  Expect = 8e-161
 Identities = 372/438 84%, Positives = 401/438 91%, Gaps = 2/438 0%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            MPISKIH+R VYDSRGNPTVEVD+ TETGLHRAIVPS ASTG HEA ELRDGDK++W GK
Sbjct  1    MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELRDGDKTQWGGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GV KAV NVNE I PALIKEN+DVKDQ+ VD FLNKLDGT NK+ +GANAILGVS+AVAK
Sbjct  61   GVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGTANKSNLGANAILGVSLAVAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            A AAEK VPLYAHISDL+GTKKP+VLPVPF NV+NGGSHAGGRLAFQEFMIVP  APSF+
Sbjct  121  AGAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFS 180
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EA+RQGAEVYQKLK+L KK+YGQSAGNVGDEGGVAPDIQTAEEALDLIT+AIE+AGYTG+
Sbjct  181  EALRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGK 240
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            IKIAMDVASSEFYKAD KKYDLDFKNP+SD SKW+TYEQLAD Y  LAAKYPIVSIEDPF
Sbjct  241  IKIAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF 300
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
            AEDDWEAWSYFYKT  SDFQIVGDDLTVTNP  IKKAIE K+CNALLLKVNQIGT+TE+I
Sbjct  301  AEDDWEAWSYFYKT--SDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQIGTLTESI 358
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             AAKDS+A  WGVMVSHRSGETEDVTIADI VGLR+GQIKTGAP RSERLAKLNQILRIE
Sbjct  359  QAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPCRSERLAKLNQILRIE 418
Query  421  EELGDKRLYAGDNFRTAINL 440
            EELG+  +YAG  FRTA+NL
Sbjct  419  EELGENTVYAGSKFRTAVNL 438

Sequence Alignment: 5. Allergen Name: Pen c 22.0101 Sequence ID: AAK51201

 Score = 554.5 bits 2405,  Expect = 4e-159
 Identities = 368/438 84%, Positives = 398/438 90%, Gaps = 2/438 0%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            MPI+K+H+R VY SRGNPTVEVD+VTETGLHRAIVPS ASTG HEA ELRDGDK+KW GK
Sbjct  1    MPIAKVHARSVYVSRGNPTVEVDVVTETGLHRAIVPSGASTGQHEAVELRDGDKAKWGGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GV KAV NVNE I PALIKEN+DVKDQA VD FLNKLDGT NK  +GANAILGVS+A+AK
Sbjct  61   GVLKAVKNVNETIGPALIKENIDVKDQAKVDEFLNKLDGTANKGNLGANAILGVSLAIAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            AAAAEK VPLY HISDL+GTKKP+VLPVPF NV+NGGSHAGGRLAFQEFMIVP  A SF+
Sbjct  121  AAAAEKGVPLYVHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDTAESFS 180
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            E +RQGAEVYQKLK+L KK+YGQSAGNVGDEGGVAPDIQTAEEALDLIT+AIE+AGYTG+
Sbjct  181  EGLRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGK 240
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            I IAMDVASSEFYK D KKYDLDFKNPDSD +KW+TYEQLAD Y  LAAKYPIVSIEDPF
Sbjct  241  ISIAMDVASSEFYKTDAKKYDLDFKNPDSDPTKWLTYEQLADLYKSLAAKYPIVSIEDPF 300
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
            AEDDWEAWSYFYKT  SDFQIVGDDLTVTNP  IKKAIE K+CNALLLKVNQIGT+TE+I
Sbjct  301  AEDDWEAWSYFYKT--SDFQIVGDDLTVTNPLRIKKAIELKSCNALLLKVNQIGTLTESI 358
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             AAKDS+A  WGVMVSHRSGETEDVTIADI VGLR+GQIKTGAPARSERLAKLNQILRIE
Sbjct  359  QAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPARSERLAKLNQILRIE 418
Query  421  EELGDKRLYAGDNFRTAINL 440
            EELG+  +YAG NFRT++NL
Sbjct  419  EELGENAIYAGKNFRTSVNL 438

Sequence Alignment: 6. Allergen Name: Cur l 2.0101 Sequence ID: AAK67491

 Score = 550.9 bits 2389,  Expect = 5e-158
 Identities = 375/436 86%, Positives = 400/436 91%, Gaps = 6/436 1%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M I+KIH+R VYDSRGNPTVEVDIVTETGLHRAIVPS ASTGSHEACELRDGDK+KW GK
Sbjct  1    MAITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKTKWGGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GVTKAVANVN+IIAPALIKE LDVKDQ+AVDAFLNKLDGT NKTK+GANAILGVSMA+AK
Sbjct  61   GVTKAVANVNDIIAPALIKEKLDVKDQSAVDAFLNKLDGTENKTKLGANAILGVSMAIAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            AAAAEK VPLYAHISDL+GTKKP+V+     NV+NGGSHAGG L FQEFMI P  A +F 
Sbjct  121  AAAAEKGVPLYAHISDLAGTKKPYVFRFLSKNVLNGGSHAGGFLLFQEFMIAP--AKTFA 178
Query  181  EAMR--QGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYT 238
            EA+R  QGAEVYQKLK+LTKK YGQSAGN GDEGGVAPDIQTAEEALDLI DAIE AG+T
Sbjct  179  EALRIRQGAEVYQKLKALTKKTYGQSAGNYGDEGGVAPDIQTAEEALDLIVDAIEAAGHT 238
Query  239  GQIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIED 298
            GQIKIAMDVASSEF+K DEKKYDLDFKNPDSDKSKW+TY QLA+ Y  LA KYPIVSIED
Sbjct  239  GQIKIAMDVASSEFFKDDEKKYDLDFKNPDSDKSKWLTYPQLAEMYKSLAEKYPIVSIED 298
Query  299  PFAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITE 358
            PFAEDDWEAWS+FYK    DFQIVGDDLTVTNPEFIK AIE K+CNALLLKVNQIGTI+E
Sbjct  299  PFAEDDWEAWSHFYKD--GDFQIVGDDLTVTNPEFIKTAIELKSCNALLLKVNQIGTISE 356
Query  359  AINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILR 418
            AINAAKD+F AGWGVMVSHRSGETEDVTIADIVVGLR+GQIKT APARSERLAK NQILR
Sbjct  357  AINAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTNAPARSERLAKYNQILR 416
Query  419  IEEELGDKRLYAGDNFRTAINL 440
            IEEELGDKRL+AG+ F TAINL
Sbjct  417  IEEELGDKRLFAGNKFHTAINL 438

Sequence Alignment: 7. Allergen Name: Rho m 1.0101 Sequence ID: Q870B9

 Score = 495.7 bits 2147,  Expect = 2e-141
 Identities = 336/438 76%, Positives = 375/438 85%, Gaps = 3/438 0%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M ISKIHSRYVYDSRGNPTVEV++ TE G  R+IVPS ASTG HEA ELRDGDKSKW GK
Sbjct  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GV KAVANVN+ IAPALI+ N+DV DQA +D FL KLDGT NK K+GANAILGVS+A AK
Sbjct  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
Query  121  AAAAEKRVPLYAHISDLSGTKK-PFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSF 179
            A AA+K VPLY HI+D+S  K+  FVLPVPF NV+NGGSHAGG LAFQEFMIVPSGAPSF
Sbjct  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
Query  180  TEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTG 239
            +E +R G+EVY+ LKSLTKK+YGQSAGNVGDEGGVAPDI+TA+EALDLI  AIE AGYTG
Sbjct  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
Query  240  QIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDP 299
            Q+ IAMDVASSEFYK  +  YDLDFKNP+SDKSKWIT  QLA+ Y +L  +YPIVSIEDP
Sbjct  241  QVDIAMDVASSEFYK--DGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP 298
Query  300  FAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEA 359
            FAEDDWEAWS+F+       QIVGDDLTVTNP  IKKAIETKA +ALLLKVNQIGT+TE+
Sbjct  299  FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTES 358
Query  360  INAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRI 419
            I AA DS+AAGWGVMVSHRSGETED  IAD+ VG+R+GQ KTGAPARSERLAKLNQILRI
Sbjct  359  IQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRI 418
Query  420  EEELGDKRLYAGDNFRTAINL 440
            EEELGDK +YAG +F  A +L
Sbjct  419  EEELGDKAIYAGKDFHKAHSL 439

Sequence Alignment: 8. Allergen Name: Pan h 2.0101 Sequence ID: XP_034156632

 Score = 407.0 bits 1758,  Expect = 9e-115
 Identities = 276/429 64%, Positives = 335/429 78%, Gaps = 6/429 1%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M I KIH+R + DSRGNPTVEVD+ TE G  RA VPS ASTG HEA ELRDGDK+++ GK
Sbjct  1    MSIVKIHAREILDSRGNPTVEVDLYTEKGRFRAAVPSGASTGVHEALELRDGDKTRFLGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GVTKAV +VN+ IAP L+++ L V DQ  +D ++ +LD T NK+K GANAILGVS+AV K
Sbjct  61   GVTKAVDHVNKDIAPKLLEKKLSVVDQEKIDKLMLELDATENKSKFGANAILGVSLAVCK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            A AAEK VPL+ HI+DL+G     +LPVP  NV+NGGSHAG +LA QEFMI+P GA +F 
Sbjct  121  AGAAEKGVPLFRHIADLAG-HADVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFR 179
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EAMR GAEVY+ LK + K +YG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  +
Sbjct  180  EAMRIGAEVYHNLKGVIKGKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYADK 239
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            I I MDVA+SEFY++   KYDLDFK+PD D  + IT +QLAD Y  +   YP++SIEDPF
Sbjct  240  IVIGMDVAASEFYRSG--KYDLDFKSPD-DPKRHITGDQLADLYKSFIKNYPVLSIEDPF 296
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
             +DDWE W+ F  TS  D QIVGDDLTVTNP+ I++A+E KACN LLLKVNQIG++TE+I
Sbjct  297  DQDDWENWTKF--TSSVDIQIVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESI 354
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             A K +   GWGVMVSHRSGETED  IAD+VVGL  GQIKTGAP RSERLAK NQ++RIE
Sbjct  355  QACKLAQKNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
Query  421  EELGDKRLYAGDNFR 435
            E+LGDK  +AG +FR
Sbjct  415  EQLGDKAKFAGKDFR 429

Sequence Alignment: 9. Allergen Name: Cyp c 2.0101 Sequence ID: A0A2U9IY94

 Score = 405.7 bits 1752,  Expect = 2e-114
 Identities = 276/429 64%, Positives = 332/429 77%, Gaps = 6/429 1%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M ISKIH+R + DSRGNPTVEVD+ T  G  RA VPS ASTG HEA ELRDGDK+++ GK
Sbjct  1    MSISKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKTRYLGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            G  KAV +VN+ IAP LI++ + V +Q  +D F+ +LDGT NK+K GANAILGVS+AV K
Sbjct  61   GTQKAVDHVNKEIAPKLIEKKFSVVEQEKIDKFMLELDGTENKSKFGANAILGVSLAVCK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            A AAEK VPLY HI+DL+G K   +LPVP  NV+NGGSHAG +LA QEFMI+P GA +F 
Sbjct  121  AGAAEKGVPLYRHIADLAGNKD-VILPVPAFNVINGGSHAGNKLAMQEFMILPVGAKNFH 179
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EAMR GAEVY+ LK++ K +YG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  +
Sbjct  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYPDK 239
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            I I MDVA+SEF+K    KYDLDFK+PD D  + IT +QL D Y  +   YP+ SIEDPF
Sbjct  240  IIIGMDVAASEFFK--NGKYDLDFKSPD-DPKRHITGDQLGDLYKSFIKNYPVQSIEDPF 296
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
             +DDWE WS F  T   D Q+VGDDLTVTNP+ I++A E KACN LLLKVNQIG++TE+I
Sbjct  297  DQDDWENWSKF--TGSVDIQVVGDDLTVTNPKRIQQACEKKACNCLLLKVNQIGSVTESI 354
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             A K + + GWGVMVSHRSGETED  IAD+VVGL  GQIKTGAP RSERLAK NQ++RIE
Sbjct  355  QACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
Query  421  EELGDKRLYAGDNFR 435
            EELGDK  +AG +FR
Sbjct  415  EELGDKAKFAGKDFR 429

Sequence Alignment: 10. Allergen Name: Sal s 2.0101 Sequence ID: B5DGQ7

 Score = 403.4 bits 1742,  Expect = 1e-113
 Identities = 274/429 63%, Positives = 334/429 77%, Gaps = 6/429 1%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M I+KIH+R + DSRGNPTVEVD+ T  G  RA VPS ASTG HEA ELRDGDKS++ GK
Sbjct  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            G  KAV +VN+ IA  LI++ + V DQ  +D F+ +LDGT NK+K GANAILGVS+AV K
Sbjct  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            A AAEK VPLY HI+DL+G  K  +LP P  NV+NGGSHAG +LA QEFMI+P GA +F 
Sbjct  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            EAMR GAEVY+ LK++ K +YG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  +
Sbjct  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDK 239
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            I I MDVA+SEFYKA   KYDLDFK+PD D +++IT +QL D Y  +   YP+ SIEDPF
Sbjct  240  IIIGMDVAASEFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF 296
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
             +DDW AW+ F  T+  D Q+VGDDLTVTNP+ I++A+E KACN LLLKVNQIG++TE+I
Sbjct  297  DQDDWAAWTKF--TAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESI 354
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             A K + + GWGVMVSHRSGETED  IAD+VVGL  GQIKTGAP RSERLAK NQ++RIE
Sbjct  355  KACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
Query  421  EELGDKRLYAGDNFR 435
            EELG K  +AG ++R
Sbjct  415  EELGAKAKFAGKDYR 429

Sequence Alignment: 11. Allergen Name: Amb a 12.0102 Sequence ID: A0A1B2H9Q5

 Score = 383.1 bits 1653,  Expect = 2e-107
 Identities = 266/432 61%, Positives = 324/432 75%, Gaps = 11/432 2%
Query  3    ISKIHSRYVYDSRGNPTVEVDIVTETG-LHRAIVPSVASTGSHEACELRDGDKSKWAGKG 61
            I  + +R ++DSRGNPTVEVDI    G L RA VPS ASTG +EA ELRDG  S + GKG
Sbjct  4    IKAVKARQIFDSRGNPTVEVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKG 62
Query  62   VTKAVANVNEIIAPALIKENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILGVS 115
            V+KAVANVN II PAL+ +  D  DQ  +D F+  +LDGT N     K K+GANAIL VS
Sbjct  63   VSKAVANVNTIIGPALVGK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS 120
Query  116  MAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSG 175
            +AV KA A+  + PLY HI++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P G
Sbjct  121  LAVCKAGASVLKTPLYKHIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIG 179
Query  176  APSFTEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEA 235
            A SF EAM+ G EVY+ LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI +A
Sbjct  180  ASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA 239
Query  236  GYTGQIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVS 295
            GYT ++ I MDVA+SEFY   +K YDL+FK  ++D  + I+ EQL D Y  + ++YPIVS
Sbjct  240  GYTDKVVIGMDVAASEFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVS 299
Query  296  IEDPFAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGT 355
            IEDPF +DDWE ++      G   QIVGDDL VTNP  +KKAI+ K CNALLLKVNQIG+
Sbjct  300  IEDPFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGS 359
Query  356  ITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQ 415
            +TE+I A + S  AGWGVM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK NQ
Sbjct  360  VTESIEAVRMSKHAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
Query  416  ILRIEEELGDKRLYAGDNFRTAI 438
            +LRIEEELG + +YAG NFR  +
Sbjct  420  LLRIEEELGSEAVYAGANFRKPV 442

Sequence Alignment: 12. Allergen Name: Gal d 9.0101 Sequence ID: P07322

 Score = 381.7 bits 1647,  Expect = 4e-107
 Identities = 260/429 60%, Positives = 320/429 74%, Gaps = 6/429 1%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
            M I KIH+R + DSRG PTVEVD+ T  G  RA VPS ASTG HEA E RDGDK ++ GK
Sbjct  1    MSIQKIHAREILDSRGEPTVEVDLHTAKGHFRAAVPSGASTGIHEALEPRDGDKKRFLGK 60
Query  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
            GV KAV ++N+ I PALI++ + V +Q  +D  + ++DGT NK+K GANAILGVS+AV K
Sbjct  61   GVLKAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCK 120
Query  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
            A AAEK VPLY HI+DL+G  + ++LPVP  NV+NGGSHAG +LA QEFM++P GA SF 
Sbjct  121  AGAAEKGVPLYRHIADLAGNTE-LILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASFH 179
Query  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
            +AMR GAEVY+ LK + K +YG+ A NVG EGG AP+I    EAL+L+  AI +AGYT +
Sbjct  180  DAMRVGAEVYHSLKGVIKAKYGKDATNVGGEGGFAPNILDNHEALELLKAAIAQAGYTDK 239
Query  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
            + I MDVA+SEF +  + +Y LDFK+P   K ++IT EQL + Y  +   YP+VSIEDPF
Sbjct  240  VVIGMDVAASEFCR--DGRYHLDFKSPPHTK-RYITGEQLGEIYRGFIKDYPVVSIEDPF 296
Query  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
             +DDWEAW  F      D Q+VGDDLTVTNP+ I    E  ACN LLLKVNQIG++TE+I
Sbjct  297  DQDDWEAWKRF--VFHVDIQVVGDDLTVTNPKRIAHGAEQHACNCLLLKVNQIGSVTESI 354
Query  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
             A K + + GWGVMVSHRSGETED  IAD+VVGL  GQIKTGAP RSERLAK NQ++RIE
Sbjct  355  QACKLAQSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
Query  421  EELGDKRLYAGDNFR 435
            E LGDK  +AG  FR
Sbjct  415  EALGDKAKFAGRKFR 429

Sequence Alignment: 13. Allergen Name: Hev b 9 Sequence ID: Q9LEJ0

 Score = 380.1 bits 1640,  Expect = 1e-106
 Identities = 266/433 61%, Positives = 328/433 75%, Gaps = 12/433 2%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETG-LHRAIVPSVASTGSHEACELRDGDKSKWAG 59
            + I  + +R ++DSRGNPTVE D+    G L RA VPS ASTG +EA ELRDG  S + G
Sbjct  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGG-SDYLG 61
Query  60   KGVTKAVANVNEIIAPALIKENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILG 113
            KGV+KAV NVN II PAL+ +  D  DQ  +D F+  +LDGT N     K K+GANAIL 
Sbjct  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
Query  114  VSMAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVP 173
            VS+AV KA A  K +PLY HI++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  120  VSLAVCKAGAHVKGIPLYEHIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
Query  174  SGAPSFTEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIE 233
             GA SF EAM+ GAEVY+ LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
Query  234  EAGYTGQIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPI 293
            +AGYTG++ I MDVA+SEFY +D+  YDL+FK  +++ S+ I+ E L D Y  + A+YPI
Sbjct  239  KAGYTGKVVIGMDVAASEFYGSDQT-YDLNFKEENNNGSQKISGEALKDLYKSFVAEYPI 297
Query  294  VSIEDPFAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQI 353
            VSIEDPF +DDW  ++ +    G   QIVGDDL VTNP+ ++KAI+ KACNALLLKVNQI
Sbjct  298  VSIEDPFDQDDWAHYAKLTSEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
Query  354  GTITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKL 413
            G++TE+I A K S  AGWGVM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK 
Sbjct  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
Query  414  NQILRIEEELGDKRLYAGDNFRTAI 438
            NQ+LRIEEELG + +YAG NFR  +
Sbjct  418  NQLLRIEEELGSEAVYAGANFRKPV 442

Sequence Alignment: 14. Allergen Name: Hev b 9 Sequence ID: Q9LEI9

 Score = 379.2 bits 1636,  Expect = 2e-106
 Identities = 265/433 61%, Positives = 328/433 75%, Gaps = 12/433 2%
Query  1    MPISKIHSRYVYDSRGNPTVEVDIVTETG-LHRAIVPSVASTGSHEACELRDGDKSKWAG 59
            + I  + +R ++DSRGNPTVE D+    G L RA VP  ASTG +EA ELRDG  S + G
Sbjct  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
Query  60   KGVTKAVANVNEIIAPALIKENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILG 113
            KGV+KAV NVN II PAL+ +  D  DQ  +D F+  +LDGT N     K K+GANAIL 
Sbjct  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
Query  114  VSMAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVP 173
            VS+AV KA A  K +PLY H+++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
Query  174  SGAPSFTEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIE 233
             GA SF EAM+ GAEVY+ LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
Query  234  EAGYTGQIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPI 293
            +AGYTG++ I MDVA+SEFY +D K YDL+FK  +++ S+ I+ + L D Y  +  +YPI
Sbjct  239  KAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
Query  294  VSIEDPFAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQI 353
            VSIEDPF +DDWE ++ +    G   QIVGDDL VTNP+ ++KAI+ KACNALLLKVNQI
Sbjct  298  VSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
Query  354  GTITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKL 413
            G++TE+I A K S  AGWGVM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK 
Sbjct  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
Query  414  NQILRIEEELGDKRLYAGDNFRTAI 438
            NQ+LRIEEELG + +YAG NFRT +
Sbjct  418  NQLLRIEEELGAEAVYAGANFRTPV 442

Sequence Alignment: 15. Allergen Name: Amb a 12.0101 Sequence ID: A0A1B2H9Q1

 Score = 363.7 bits 1568,  Expect = 1e-101
 Identities = 254/415 61%, Positives = 310/415 74%, Gaps = 11/415 2%
Query  20   VEVDIVTETG-LHRAIVPSVASTGSHEACELRDGDKSKWAGKGVTKAVANVNEIIAPALI 78
            ++VDI    G L RA VPS ASTG +EA ELRDG  S + GKGV+KAVANVN II PAL+
Sbjct  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
Query  79   KENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILGVSMAVAKAAAAEKRVPLYA 132
             +  D  DQ  +D F+  +LDGT N     K K+GANAIL V +AV KA A+  + PLY 
Sbjct  66   GK--DPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
Query  133  HISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFTEAMRQGAEVYQK 192
            HI++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P GA SF EAM+ G EVY+ 
Sbjct  124  HIANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN 182
Query  193  LKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQIKIAMDVASSEF 252
            LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI +AGYT ++ I MDVA+SEF
Sbjct  183  LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEF 242
Query  253  YKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPFAEDDWEAWSYFY 312
            Y   +K YDL+FK  ++D  + I+ EQL D Y  + ++YPIVSIEDPF +DDWE ++   
Sbjct  243  YGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMT 302
Query  313  KTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAINAAKDSFAAGWG 372
               G   QIVGDDL VTNP  +KKAI+ K CNALLLKVNQIG++TE+I A + S  AGWG
Sbjct  303  AECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWG 362
Query  373  VMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIEEELGDKRLYAGD 432
            VM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK NQ+LRIEEELG + +YAG 
Sbjct  363  VMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGA 422
Query  433  NFRTAI 438
            NFR  +
Sbjct  423  NFRKPV 428

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.