The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI
HSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLI
LYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
Sequence Info Allergen Name Length Opt Bits Score E Value
O18874 Can f 2 180 1224 286.0 4.3e-79
P02761 Rat n 1 181 335 83.4 4.3e-18
P02762 Mus m 1 180 322 80.4 3.3e-17
AAA39768 Mus m 1.0102 180 320 79.9 4.6e-17
U6C8D6 Ory c 4.0101 172 282 71.3 1.7e-14
S0BDX9 Cav p 6.0101 181 279 70.6 3e-14
Q95182 Equ c 1 187 272 69.0 9.5e-14
XP_855342 Can f 6.0101 190 245 62.8 6.9e-12
AAS77253 Fel d 4 186 236 60.8 2.8e-11
O18873 Can f 1 174 212 55.3 1.1e-09
ADK56160 Fel d 7.0101 180 204 53.5 4.2e-09
P02754 Bos d 5 178 197 51.9 1.2e-08
CAA32835 Bos d 5 178 193 51.0 2.3e-08
CAX62130 Cav p 3.0101 170 181 48.3 1.5e-07
AAA30411 Bos d 5 151 160 43.6 3.4e-06
Q9QXU1 Mes a 1.0101 172 134 37.6 0.00025
S5ZYD3 Phod s 1.0101 151 122 34.9 0.0014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 286.0 bits 1224,  Expect = 4e-79
 Identities = 180/180 100%, Positives = 180/180 100%, Gaps = 0/180 0%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
            MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI
Sbjct  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
Query  61   HSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLI 120
            HSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLI
Sbjct  61   HSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLI 120
Query  121  LYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD 180
            LYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
Sbjct  121  LYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD 180

Sequence Alignment: 2. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 83.4 bits 335,  Expect = 4e-18
 Identities = 56/178 31%, Positives = 99/178 55%, Gaps = 1/178 0%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
            + LLLL +GL L+CG +A+E +       + +L+G W S+ +ASNK + I+  G  RVF+
Sbjct  3    LLLLLLCLGLTLVCG-HAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFM 61
Query  61   HSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLI 120
            + +   + +L     I ++G+C ++ L A+KT    ++ +EY G N + + + D   Y++
Sbjct  62   QHIDVLENSLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVM 121
Query  121  LYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSR 179
            +++IN  N +T  +  L  R      D    F  +CE  G+ +D I+ L+  DRC  +R
Sbjct  122  FHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQAR 180

Sequence Alignment: 3. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 80.4 bits 322,  Expect = 3e-17
 Identities = 51/177 28%, Positives = 104/177 58%, Gaps = 1/177 0%
Query  3    LLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHS 62
            LLLL +GL L+C ++A+E +       +E+++G WH++ LAS+K + I+  G+FR+F+  
Sbjct  4    LLLLCLGLTLVC-VHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQ 62
Query  63   MSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILY 122
            +   + +L       +D +C ++S+ A KT  + ++ + Y G N + + + D  ++L+ +
Sbjct  63   IHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAH 122
Query  123  MINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD 180
            +IN+ + +T  +  L  R+     D    F  +CE+ G+ ++ I+ LS+ +RC  +R+
Sbjct  123  LINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE 180

Sequence Alignment: 4. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 79.9 bits 320,  Expect = 5e-17
 Identities = 51/177 28%, Positives = 104/177 58%, Gaps = 1/177 0%
Query  3    LLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHS 62
            LLLL +GL L+C ++A+E +       +E+++G WH++ LAS+K + I+  G+FR+F+  
Sbjct  4    LLLLCLGLTLVC-VHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQ 62
Query  63   MSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILY 122
            +   + +L       +D +C ++S+ A KT  + ++ + Y G N + + + D  ++L+ +
Sbjct  63   IHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAH 122
Query  123  MINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD 180
            +IN+ + +T  +  L  R+     D    F  +CE+ G+ ++ I+ LS+ +RC  +R+
Sbjct  123  LINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE 180

Sequence Alignment: 5. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 71.3 bits 282,  Expect = 2e-14
 Identities = 51/165 30%, Positives = 95/165 57%, Gaps = 6/165 3%
Query  12   LICGLQAQEGN-HEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSA-KDGN 69
            LIC  +  + + H E    + ++SG W+SV LAS+  + I+  G  RVF+  +   K+ +
Sbjct  2    LICAPKRGDAHSHSE----VSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSS 57
Query  70   LHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYND 129
            L      P +G+C ++ LT   T  ++ + +EY GHN + + ++ P  Y+I+++IN+ N 
Sbjct  58   LSFKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNG 117
Query  130  DTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD 180
            ++  +  L  R L  + D    F  +C++ G+ ++ I+ L+  DRC  +RD
Sbjct  118  ESFQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARD 168

Sequence Alignment: 6. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 70.6 bits 279,  Expect = 3e-14
 Identities = 56/175 32%, Positives = 97/175 55%, Gaps = 7/175 4%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGL--EELSGRWHSVALASNKSDLIKPWGHFRV 58
            M+L LL +GL L+C     EG+ E  +G +  E++SG W++V  AS+K + I+  G  RV
Sbjct  1    MKLQLLCLGLILLC--TQGEGD-EVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRV 57
Query  59   FIHSMS-AKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKS 117
            F+ S+   KD  L       ++G+C+++SL   + A    + +EY G+N + +AE D K+
Sbjct  58   FVESIEPVKDSALSFKFWAHENGECKQISLICNRVAEGV-YAVEYDGYNVFRVAETDYKN 116
Query  118  YLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQG 177
            Y I+ + N   + +  +  L  R+     +    FE  C   G+ +  I+ ++  DRC  
Sbjct  117  YAIFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQ 176
Query  178  SR 179
            +R
Sbjct  177  AR 178

Sequence Alignment: 7. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 69.0 bits 272,  Expect = 9e-14
 Identities = 48/175 27%, Positives = 90/175 51%, Gaps = 1/175 0%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
            M+LLLL +GL L+C  Q +  +       + ++SG W+S+ LAS+  + I+  G  RVF+
Sbjct  1    MKLLLLCLGLILVCAQQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFV 60
Query  61   HSMSAKDGN-LHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYL 119
              + A D + L+ +     +G+C +  +   KT     + L Y G+N + ++E +   ++
Sbjct  61   DVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHI 120
Query  120  ILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC 175
            ILY++N   D    +  +  R+     +    F  + +  G+ K+ I+ L+  DRC
Sbjct  121  ILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRC 176

Sequence Alignment: 8. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 62.8 bits 245,  Expect = 7e-12
 Identities = 49/176 27%, Positives = 95/176 53%, Gaps = 6/176 3%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLE--ELSGRWHSVALASNKSDLIKPWGHFRV 58
            M+LLLL +GL L+   +A+E  ++  +G ++  ++SG W+S+ LAS+  + I+  G  RV
Sbjct  1    MKLLLLCLGLILV---HAHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRV 57
Query  59   FIHSMSA-KDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKS 117
            F+  +    + +L   +    +G+C K+SL   KT    ++D+ + G+N + + E   + 
Sbjct  58   FVKDIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYED 117
Query  118  YLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQG 177
            Y+I+++ N   +    +  L  R           F   C+ + + K+ I+ L+  DRC  
Sbjct  118  YIIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQ 177
Query  178  SR 179
            +R
Sbjct  178  AR 179

Sequence Alignment: 9. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 60.8 bits 236,  Expect = 3e-11
 Identities = 49/174 28%, Positives = 92/174 52%, Gaps = 6/174 3%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
            M+LLLL +GL L+C    +E N       + ++SG W+S+ LAS+  + I+  G  RVF+
Sbjct  1    MKLLLLCLGLILVCA--HEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFV 58
Query  61   HSMSAKDGNLHGDIL-IPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYL 119
              + A D +    ++   ++G+C ++ L A KT     + + Y G+N + + E     Y+
Sbjct  59   EHIKALDNSSLSFVFHTKENGKCTEIFLVADKTK-DGVYTVVYDGYNVFSIVETVYDEYI 117
Query  120  ILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSR 179
            +L+++N        +  +  R+    Q +   F   C++ G+    I+ L++ DRC  +R
Sbjct  118  LLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQAR 175

Sequence Alignment: 10. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 55.3 bits 212,  Expect = 1e-09
 Identities = 48/167 28%, Positives = 90/167 53%, Gaps = 10/167 5%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEEL--SGRWHSVALASNKSDLIKPWGHFRV 58
            M+ LLLT+G++LI  LQAQ+     P  G + +  SG+W+  A+ +++    KP     +
Sbjct  1    MKTLLLTIGFSLIAILQAQD----TPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPM 56
Query  59   FIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSY 118
             + +   K GNL   I +  +GQC+ +++   KT+   K+   Y G+  +++     + +
Sbjct  57   ILKAQ--KGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYT-AYEGQRVVFIQPSPVRDH 113
Query  119  LILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC 175
             ILY   + +     +A L+ RD  + Q+ L  F       GL+++ I+ L+  + C
Sbjct  114  YILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQE-ILELAQSETC 169

Sequence Alignment: 11. Allergen Name: Fel d 7.0101 Sequence ID: ADK56160

 Score = 53.5 bits 204,  Expect = 4e-09
 Identities = 50/171 29%, Positives = 89/171 52%, Gaps = 13/171 7%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEEL--SGRWHSVALASNK-SDLIKPWGHFR 57
            M+ LLL VGL+LI  LQAQ+     P  G + +  SG+W+  A+ +++ +   KP     
Sbjct  1    MKALLLAVGLSLITVLQAQD----PPASGEDTMAMSGKWYLKAMITDRETSWKKPE---L 53
Query  58   VFIHSMSA-KDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPK 116
            V   +++  + GNL  +  +  +GQC++V L   KT+   K+   Y G   +Y+   + K
Sbjct  54   VTPMTLTVLEGGNLKAETTLLTNGQCKEVELILEKTSEPKKYTT-YGGKRVVYIEPTEVK 112
Query  117  SYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQ 176
             + I+Y   +   + + +A L+ RD    ++ L  F       G++++ I      D C 
Sbjct  113  DHYIFYCEGEMQGEQARMAKLVGRDPESNEEALENFREFLRAKGFNQE-IFSPKQSDTCP 171
Query  177  GSRD 180
               D
Sbjct  172  PGTD 175

Sequence Alignment: 12. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 51.9 bits 197,  Expect = 1e-08
 Identities = 43/158 27%, Positives = 84/158 53%, Gaps = 8/158 5%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGH-FRVF 59
            M+ LLL   LAL CG QA    +      +++++G W+S+A+A++   L+      +RV+
Sbjct  1    MKCLLLA--LALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
Query  60   IHSMS-AKDGNLHGDILIPQ--DGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPK 116
            +  +    +G+L  +IL+ +  +G+C +  + A KT     F ++    N + + + D K
Sbjct  59   VEELKPTPEGDL--EILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYK 116
Query  117  SYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLH 162
             YL++ M N    + SL  + +VR      + L  F+   + + +H
Sbjct  117  KYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMH 162

Sequence Alignment: 13. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 51.0 bits 193,  Expect = 2e-08
 Identities = 43/158 27%, Positives = 84/158 53%, Gaps = 8/158 5%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGH-FRVF 59
            M+ LLL   LAL CG QA    +      +++++G W+S+A+A++   L+      +RV+
Sbjct  1    MKCLLLA--LALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
Query  60   IHSMS-AKDGNLHGDILIPQ--DGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPK 116
            +  +    +G+L  +IL+ +  + +C +  + A KT     F ++    N + + + D K
Sbjct  59   VEELKPTPEGDL--EILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYK 116
Query  117  SYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLH 162
             YL++ M N    + SLV + +VR      + L  F+   + + +H
Sbjct  117  KYLLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMH 162

Sequence Alignment: 14. Allergen Name: Cav p 3.0101 Sequence ID: CAX62130

 Score = 48.3 bits 181,  Expect = 1e-07
 Identities = 47/163 28%, Positives = 85/163 52%, Gaps = 17/163 10%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
            MQ+LLL    AL  GL A      +P     E++G+WH++++A++  + I   G +R + 
Sbjct  1    MQILLL----ALTIGL-AYAHQTLDPS----EINGQWHTISIAADNVEKIGEGGPLRGYF 51
Query  61   HSMSAKDG--NLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSY 118
            H++   DG  N+     +  DG C++  +   K   S+ +  +Y G N +   EV  K  
Sbjct  52   HNLHCYDGCKNIGLTFYVKLDGNCQRFDVLGAKQEDSDVYVAQYSGTNHF---EVIGKKE 108
Query  119  LILYMINQYNDDTSLVAHLMV---RDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC 175
              +   N+  D+T     ++V   R  S  ++    ++ V  + G+ KD I  + + D C
Sbjct  109  DAIAFYNHNTDETGKETKMIVVVARRDSLTEEEQQKLQEVAGEKGIPKDNIRYFRERDTC 168

Sequence Alignment: 15. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 43.6 bits 160,  Expect = 3e-06
 Identities = 32/131 24%, Positives = 71/131 54%, Gaps = 6/131 4%
Query  30   LEELSGRWHSVALASNKSDLIKPWGH-FRVFIHSMS-AKDGNLHGDILIPQ--DGQCEKV 85
            +++++G W+S+A+A++   L+      +RV++  +    +G+L  +IL+ +  + +C + 
Sbjct  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDL--EILLQKWENDECAQK 58
Query  86   SLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQ 145
             + A KT     F ++    N + + + D K YL++ M N    + SLV + +VR     
Sbjct  59   KIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVD 118
Query  146  QDFLPAFESVCEDIGLH 162
             + L  F+   + + +H
Sbjct  119  DEALEKFDKALKALPMH 135

Sequence Alignment: 16. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 37.6 bits 134,  Expect = 0.0002
 Identities = 36/167 21%, Positives = 76/167 45%, Gaps = 10/167 5%
Query  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
            +++LLL + L + C   AQ  N E       E+ G+WHS+ +A++    +   G +RV++
Sbjct  2    VKFLLLALALGVSC---AQHQNLEVSPS---EVDGKWHSLYIAADNKSKVSEGGPLRVYV 55
Query  61   HSMSAKD--GNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSY 118
              +   D    +        +  C++  +   K     K+  ++ G+N +++ E      
Sbjct  56   KHLECSDECQTFTIKFYTKVENVCQEHRVVGRK-GKDGKYITDFSGQNYFHVVE-KADDT 113
Query  119  LILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC 175
            + ++ +N  +   + V  ++ +  S   +    FE   E   + K+ I  L   D C
Sbjct  114  MTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170

Sequence Alignment: 17. Allergen Name: Phod s 1.0101 Sequence ID: S5ZYD3

 Score = 34.9 bits 122,  Expect = 0.001
 Identities = 20/102 19%, Positives = 51/102 50%, Gaps = 4/102 3%
Query  32   ELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKD--GNLHGDILIPQDGQCEKVSLTA 89
            EL G+W ++A+A++    IK  G +R+++  +   +    +     +  + QC K ++  
Sbjct  5    ELEGKWDTIAIAADNDAKIKEEGPLRLYVRELYCNEDCSEMEVTFYVNANNQCSKTTVIG 64
Query  90   FKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYM-INQYNDDTSLV 134
            +K A    +  ++ G N +      P++ +     +++   +T+L+
Sbjct  65   YKQA-DGTYRTQFEGDNRFQPVYATPENIVFTSKNVDRAGQETNLI 109

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.