The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI
HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL
DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY
NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND
IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA
ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL
YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA35594 Asp o 13 403 2566 591.3 2.7e-170
AAD47202 Asp fl protease 403 2561 590.1 6e-170
P28296 Asp f 13 403 2146 495.5 1.8e-141
ADE74975 Asp v 13.0101 403 1972 455.9 1.6e-129
AAD52013 Tri r 2.0101 412 965 226.3 2e-60
AAD25926 Pen c 13.0101 397 955 224.1 9.3e-60
AAF23726 Pen ch 13 397 950 222.9 2.1e-59
AAF71379 Pen ch 18 494 694 164.5 9.8e-42
Q32ZM1 Rho m 2.0101 342 684 162.3 3.1e-41
AAG44478 Pen o 18 503 426 103.4 2.4e-23
A0A0F6N3V8 Alt a 15.0101 507 425 103.2 2.9e-23
ACF19589 Cur l 4.0101 506 419 101.8 7.4e-23
Y13338 Asp f 18.0101 495 416 101.1 1.2e-22
ABQ59329 Cla c 9.0101 388 409 99.6 2.7e-22
A0A0U1Y1N5 Fus p 9.0101 386 407 99.1 3.6e-22
AAX14379 Cla h 9.0101 518 403 98.2 9.6e-22
BAA06905 Cuc m 1 731 146 39.5 0.00061
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asp o 13 Sequence ID: CAA35594

 Score = 591.3 bits 2566,  Expect = 3e-170
 Identities = 403/403 100%, Positives = 403/403 100%, Gaps = 0/403 0%
Query  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
            MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI
Sbjct  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
Query  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
            HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL
Sbjct  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
Query  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
            DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY
Sbjct  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
Query  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
            NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND
Sbjct  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
Query  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
            IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA
Sbjct  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
Query  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
            ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL
Sbjct  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
Query  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA 403
            YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA
Sbjct  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA 403

Sequence Alignment: 2. Allergen Name: Asp fl protease Sequence ID: AAD47202

 Score = 590.1 bits 2561,  Expect = 6e-170
 Identities = 402/403 99%, Positives = 403/403 100%, Gaps = 0/403 0%
Query  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
            MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI
Sbjct  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
Query  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
            HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL
Sbjct  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
Query  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
            DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY
Sbjct  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
Query  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
            NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND
Sbjct  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
Query  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
            IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA
Sbjct  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
Query  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
            ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL
Sbjct  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
Query  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA 403
            YLAALENLDGPAAVTKRI+ELATKDVVKDVKGSPNLLAYNGNA
Sbjct  361  YLAALENLDGPAAVTKRIEELATKDVVKDVKGSPNLLAYNGNA 403

Sequence Alignment: 3. Allergen Name: Asp f 13 Sequence ID: P28296

 Score = 495.5 bits 2146,  Expect = 2e-141
 Identities = 330/403 81%, Positives = 362/403 89%, Gaps = 0/403 0%
Query  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
            M SIKRTLLLLGA+LPAV+GAPVQETRRAA+K+PGKYIVTFKPG D A I+ HT WAT++
Sbjct  1    MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDL 60
Query  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
            H+R+LERR  T G+ PVGIE++YKI  FAAYAGSFDDATIEEIRK  DVA+VEEDQI+YL
Sbjct  61   HKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIEEIRKRGDVAHVEEDQIWYL 120
Query  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
            D LTTQK APWGLGSISHKGQ STDYIYDTSAG GTYAYVVDSG+NV+H EFE RAS AY
Sbjct  121  DALTTQKGAPWGLGSISHKGQASTDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAY 180
Query  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
            NAAGG HVDSIGHGTHV+GTI GKTYG+AKK ++LSVKVFQGESSSTS+ILDGFNWA ND
Sbjct  181  NAAGGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSSTSIILDGFNWAVND 240
Query  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
            IVSK RT KAAINMSLGGGYS AFN+AVENAF++GVLSVVAAGNENSDA  TSPASAP+A
Sbjct  241  IVSKGRTKKAAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDASNTSPASAPNA 300
Query  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
            +TVAAI KSN RASFSN+G VVD+FAPGQDILSAWIGS++ATNTISGTSMATPHIVGLS+
Sbjct  301  LTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSV 360
Query  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA 403
            YL  LENL GPAAVT RIKELAT  VV +VKGSPN LAYNGNA
Sbjct  361  YLMGLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA 403

Sequence Alignment: 4. Allergen Name: Asp v 13.0101 Sequence ID: ADE74975

 Score = 455.9 bits 1972,  Expect = 2e-129
 Identities = 296/401 73%, Positives = 348/401 86%, Gaps = 0/401 0%
Query  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
            M SIKRT+LLLGA+LPAV+GAP+ E RR  EK+PGKYIVTFK G+   +I  HTTWA+N+
Sbjct  1    MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQIDAHTTWASNV 60
Query  61   HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL 120
            H+R+LERR  T  DL  GIE+N+KI+KFAAY GSFDDATIEEIR ++DVA+VEEDQ++YL
Sbjct  61   HKRNLERRDLTDRDLYPGIEKNFKIHKFAAYVGSFDDATIEEIRNHKDVAHVEEDQVWYL 120
Query  121  DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY 180
            D LTTQ  APWGLG+ISH+G  S+DYIYDTSAG  TYAYVVD+G+NVDH EF+GRAS AY
Sbjct  121  DALTTQSDAPWGLGAISHQGDASSDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAY 180
Query  181  NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND 240
            NAAGGQHVDS+GHGTHV+GTI GKT+G++KKA++LSVKVF+GESSSTS+ILDG+NWAAND
Sbjct  181  NAAGGQHVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSSTSIILDGYNWAAND 240
Query  241  IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
            IVSK RT K+AIN+SLGGGYS AF++AVE+AF++GVLSVVAAGNEN DA  TSPASAP+A
Sbjct  241  IVSKSRTGKSAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDASNTSPASAPNA 300
Query  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
            +TVAA  + N RASFSN+G+VVD+FAPG+DILSAWIG +SATNTISGTSMATPHIVGLSL
Sbjct  301  LTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSL 360
Query  361  YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNG 401
            YL ALE L  P  VT RIKELAT+  +  V GSPN LAYNG
Sbjct  361  YLIALEGLSSPGDVTSRIKELATQGALSGVSGSPNALAYNG 401

Sequence Alignment: 5. Allergen Name: Tri r 2.0101 Sequence ID: AAD52013

 Score = 226.3 bits 965,  Expect = 2e-60
 Identities = 168/397 42%, Positives = 241/397 60%, Gaps = 18/397 4%
Query  1    MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI 60
            M  I + + ++ A L  V GA + E    AE +P KYIV  K  + +     HTTW +  
Sbjct  1    MGFITKAIPIVLAALSTVNGARILEAGPHAEAIPNKYIVVMKREVSDEAFNAHTTWLSQS 60
Query  61   HQRSLERRGATGGDLPVGIERNYKINK-FAAYAGSFDDATIEEIRKNEDVAYVEEDQIYY 119
                + RR  +   +  G++  Y +   F AY+G FDDA I++I  ++DV ++E D +  
Sbjct  61   LNSRIMRRAGSSKPM-AGMQDKYSLGGIFRAYSGEFDDAMIKDISSHDDVDFIEPDFVVR 119
Query  120  L--DG--LTTQKSAP-WGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEG 174
               +G  LT Q + P WGL  +  K    T Y YD SAG+G  AY++D+G+++DHE+F+G
Sbjct  120  TTTNGTNLTHQDNVPSWGLARVGSKKPGGTTYYYDPSAGKGVTAYIIDTGIDIDHEDFQG 179
Query  175  RASKAYNAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESS-STSVILDG 233
            RA    N    Q+ D  GHGTHV+GT+ G  YG+AK  S+++VKV+  + S S S ++ G
Sbjct  180  RAKWGENFVDQQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNSGVIKG 239
Query  234  FNWAANDIV-----SKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSD 288
              WA          + K   K+ +NMSLGG  S+A N A +   + G++  VAAGNEN D
Sbjct  240  MEWAMRQASGGGNGTAKAAGKSVMNMSLGGPRSEASNQAAKAISDAGIFMAVAAGNENMD 299
Query  289  AGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGT 348
            A ++SPAS P   TVAA  K + +A FSN+G VVDV+APG+DI S   G S  T+T+SGT
Sbjct  300  AQHSSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKDITSLKPGGS--TDTLSGT 357
Query  349  SMATPHIVGLSLYLAALENLDGPAAVTKRIKELATKDVVKDV-KGSPNLLAYNGN 402
            SMA+PH+ GL  YL  L    GP  +   IK++A  DV++   +G+   L YNG+
Sbjct  358  SMASPHVCGLGAYLIGLGKQGGPG-LCDTIKKMAN-DVIQSPGEGTTGKLIYNGS 410

Sequence Alignment: 6. Allergen Name: Pen c 13.0101 Sequence ID: AAD25926

 Score = 224.1 bits 955,  Expect = 9e-60
 Identities = 155/361 42%, Positives = 219/361 60%, Gaps = 10/361 2%
Query  33   LPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGATGGDLPVGIERNYKINKFAAYA 92
            +P  YIV     +  A+   H  WATN+H R L RR    G+   G  ++++IN +  Y 
Sbjct  32   IPSSYIVVMNDDVSTAEFNTHREWATNVHAR-LSRR--KNGETGPG--KHFEINGLKGYT 86
Query  93   GSFDDATIEEIRKNEDVAYVEEDQIYYLDGLTTQKSAP-WGLGSISHKGQQSTDYIYDTS 151
             SFD++T ++I  +  V Y+E D I        Q + P WGL  IS K   +T Y YD++
Sbjct  87   ASFDESTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
Query  152  AGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQHVDSIGHGTHVSGTIAGKTYGIAKK 211
            AGEG   Y VD+G+++ H +F GRA    N     + D  GHGTH + T AG  YG+AKK
Sbjct  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
Query  212  ASILSVKVFQGESSST-SVILDGFNWAANDIVSKKRTSKAAINMSLGGGYSKAFNDAVEN 270
            A++++VKV+  + S T S ++ G +WA  D  S+    K  +NMSLGG +SKA NDA  N
Sbjct  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNMSLGGEFSKAVNDAAAN 266
Query  271  AFEQGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQD 330
              + G++  VAAGNE  +A  +SPASA +  T+AA   ++  ASF+NFG VVD++APGQ 
Sbjct  267  VVKSGIFLSVAAGNEAENASNSSPASAAEVCTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
Query  331  ILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALENLDGPAAVTKRIKELATKDVVKDV 390
            I +A+ G  S   T+SGTSMA PH+ G++ YL ALE +    A   RI +LAT  + +  
Sbjct  327  ITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSAGNACA-RIVQLATSSISRAP 383
Query  391  KGSPNLLAYNG 401
             G+ + L YNG
Sbjct  384  SGTTSKLLYNG 394

Sequence Alignment: 7. Allergen Name: Pen ch 13 Sequence ID: AAF23726

 Score = 222.9 bits 950,  Expect = 2e-59
 Identities = 155/361 42%, Positives = 218/361 60%, Gaps = 10/361 2%
Query  33   LPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGATGGDLPVGIERNYKINKFAAYA 92
            +P  YIV     +  A+   H  WATN+H R L RR    G+   G  ++++IN +  Y 
Sbjct  32   IPSSYIVVMNDDVSTAEFSTHREWATNVHAR-LSRR--KNGETGPG--KHFEINGLKGYT 86
Query  93   GSFDDATIEEIRKNEDVAYVEEDQIYYLDGLTTQKSAP-WGLGSISHKGQQSTDYIYDTS 151
             SFD+ T ++I  +  V Y+E D I        Q + P WGL  IS K   +T Y YD++
Sbjct  87   ASFDENTAKDIANDPAVKYIEPDMIVNATANVVQSNVPSWGLARISSKRTGTTSYTYDST 146
Query  152  AGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQHVDSIGHGTHVSGTIAGKTYGIAKK 211
            AGEG   Y VD+G+++ H +F GRA    N     + D  GHGTH + T AG  YG+AKK
Sbjct  147  AGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKK 206
Query  212  ASILSVKVFQGESSST-SVILDGFNWAANDIVSKKRTSKAAINMSLGGGYSKAFNDAVEN 270
            A++++VKV+  + S T S ++ G +WA  D  S+    K  +N SLGG +SKA NDA  N
Sbjct  207  ATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNTSLGGEFSKAVNDAAAN 266
Query  271  AFEQGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQD 330
              + G++  VAAGNE  +A  +SPASA +A T+AA   ++  ASF+NFG VVD++APGQ 
Sbjct  267  VVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQS 326
Query  331  ILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALENLDGPAAVTKRIKELATKDVVKDV 390
            I +A+ G  S   T+SGTSMA PH+ G++ YL ALE +    A   RI +LAT  + +  
Sbjct  327  ITAAYPGGGS--KTLSGTSMAAPHVAGVAAYLMALEGVSAGNACA-RIVQLATSSISRAP 383
Query  391  KGSPNLLAYNG 401
             G+ + L YNG
Sbjct  384  SGTTSKLLYNG 394

Sequence Alignment: 8. Allergen Name: Pen ch 18 Sequence ID: AAF71379

 Score = 164.5 bits 694,  Expect = 1e-41
 Identities = 170/380 44%, Positives = 242/380 63%, Gaps = 31/380 8%
Query  21   APVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIH-----QRSLERRGATGGDL 75
            AP+  +  + + +P  YIV FK  +D +    H +W   +H     +  L++R   G D+
Sbjct  29   APILSSMTSKD-IPDSYIVVFKKHVDPSSASAHQSWLQEVHTAHTGRMELKKRSLFGFDF 87
Query  76   P--VGIERNYKI-NKFAAYAGSFDDATIEEIRKNEDVAYVEED-QIYYLDGLTTQKSAPW 131
               +G++  + I   +  YAG F +  IE+IR++ DV Y+E+D ++  +   + +K+APW
Sbjct  88   EAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTMSEGSVEKNAPW 147
Query  132  GLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQ- 186
            GL  ISH+   S      Y+Y    GEG  AYV+D+G NV H +FEGRA+       G  
Sbjct  148  GLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVKHVDFEGRANWGKTIPQGDA 207
Query  187  HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILDGFNWAANDIVSK- 244
              D  GHGTH SGTIAGK +G+AKKA++ +VKV++   S T S ++ G  WAA   + K 
Sbjct  208  DEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKKS 267
Query  245  ----KRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA 300
                K+   +  NMSLGGG S+ ++ AV  A + G+   VAAGN+N+DA   SPA+A  A
Sbjct  268  KKGDKKFKGSVANMSLGGGSSRTLDLAVNAAVDAGIHFAVAAGNDNADACNYSPAAAEKA 327
Query  301  ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL 360
            ITV A   ++ RA FSN+GK  D+FAPG +ILS W+GS  ATNTISGTSMA+PHI GL  
Sbjct  328  ITVGASTLADERAYFSNYGKCTDIFAPGLNILSTWVGSDHATNTISGTSMASPHIAGLLA 387
Query  361  YLAALENL-DGPAAVT----KRIKE----LATKDVVKDVKG-SPNLLAYNG 401
            Y  +L    D   AV     K++K     +AT+  + D+   +PNLLA+NG
Sbjct  388  YYVSLAPAKDSAYAVADVTPKQLKAALISVATEGTLTDIPSDTPNLLAWNG 438

Sequence Alignment: 9. Allergen Name: Rho m 2.0101 Sequence ID: Q32ZM1

 Score = 162.3 bits 684,  Expect = 3e-41
 Identities = 145/302 48%, Positives = 200/302 66%, Gaps = 21/302 6%
Query  100  IEEIRKNEDVAYVEEDQIYYLDGLTTQKSAPWGLGSISHKGQQST----DYIYDTSAGEG 155
            IE++R+   V ++E++ + + + +T  K APWGL  ISH+   S      Y+YD++ G G
Sbjct  9    IEQVRQLPMVNFIEKNSLVHANEFTVAKGAPWGLARISHRDPLSLGSFDQYLYDSNGGTG 68
Query  156  TYAYVVDSGVNVDHEEFEGRASKAYNAA-GGQHVDSIGHGTHVSGTIAGKTYGIAKKASI 214
              +YV+D+GVNV HE+FEGRA        G +  D  GHGTH +GTI    YG+AK A I
Sbjct  69   VTSYVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYGVAKNAEI 128
Query  215  LSVKVFQGESS-STSVILDGFNWAAN---DIVSKKRTSKAAINMSLGGGYSKAFNDAVEN 270
            ++VKV++   S S S ++ G  +A     D V K + S +  NMSLGGG S A++ AV  
Sbjct  129  VAVKVLRSNGSGSMSDVIKGVEFAVKSHQDSVKKGKNSFSTANMSLGGGKSPALDLAVNA 188
Query  271  AFEQGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQD 330
            A + G+   VAAGNEN DA  TSPASA +AITV A   S+ RA FSN+GK VD+FAPG +
Sbjct  189  AVKAGLHFAVAAGNENQDACNTSPASAENAITVGASTISDARAYFSNYGKCVDIFAPGLN 248
Query  331  ILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALE---------NLDG--PAAVTKRIK 379
            ILS +IGS +AT  +SGTSMA+PHI GL  Y  +L+           +G  PA + K + 
Sbjct  249  ILSTYIGSDAATAYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGITPAQLKKNLI 308
Query  380  ELATKDVVKDVKG-SPNLLAYNG 401
             + T DV+ D+   +PN+LA+NG
Sbjct  309  AFGTPDVLADIPADTPNILAFNG 331

Sequence Alignment: 10. Allergen Name: Pen o 18 Sequence ID: AAG44478

 Score = 103.4 bits 426,  Expect = 2e-23
 Identities = 173/382 45%, Positives = 249/382 65%, Gaps = 33/382 8%
Query  20   GAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIHQRS----LERRGATGGDL 75
            GA    +  +A+++P  YIV FK  +  +    H +W  +IH  +    L++R   G + 
Sbjct  27   GAAPLISSTSAKEIPDSYIVVFKKHVGASAASAHHSWVQDIHSDNVRMELKKRSLFGFES 86
Query  76   -P-VGIERNYKI-NKFAAYAGSFDDATIEEIRKNEDVAYVEED-QIYYLDGLTTQKSAPW 131
             P +G++  + +   +  YAG F +  IE++R++ DV Y+E+D ++++++    +K+APW
Sbjct  87   EPYLGVKHTFHVAGSLMGYAGHFHEDVIEQVRRHPDVEYIEKDSEVHHFEDPAIEKNAPW 146
Query  132  GLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAA-GGQ 186
            GL  ISH+   S      Y+Y    GEG  AYV+D+G NVDH +FEGRAS       G Q
Sbjct  147  GLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTNVDHVDFEGRASWGKTIPQGDQ 206
Query  187  HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILDGFNWAANDIVSKK 245
             VD  GHGTH SGTIAGK YG+AKKA++ +VKV++   S T S ++ G  WAA   + K 
Sbjct  207  DVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKKS 266
Query  246  RTSK---------AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPAS 296
            + +K         +  NMSLGGG S+ ++ AV  A + G+   VAAGN+N+DA   SPA+
Sbjct  267  KAAKDGKAKGFKGSVANMSLGGGSSRTLDLAVNAAVDAGMHFAVAAGNDNADACNYSPAA 326
Query  297  APDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIV 356
            A  A+TV A   ++ RA FSN+GK  D+FAPG +ILS WIGS  A NTISGTSMA+PHI 
Sbjct  327  AEKAVTVGASTLADERAYFSNYGKCTDIFAPGLNILSTWIGSKYAVNTISGTSMASPHIA 386
Query  357  GLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDVKG-SPNLLAYNG 401
            GL  Y  +L+   D   AV     K++K+    +AT   + D+   +PNLLA+NG
Sbjct  387  GLLAYYVSLQPASDSAYAVEEITPKKLKDALITIATSGALSDIPSDTPNLLAWNG 441

Sequence Alignment: 11. Allergen Name: Alt a 15.0101 Sequence ID: A0A0F6N3V8

 Score = 103.2 bits 425,  Expect = 3e-23
 Identities = 169/376 44%, Positives = 238/376 63%, Gaps = 39/376 10%
Query  24   QETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGAT---GGDLPV--- 77
            Q    +A+++P  Y+V FK  + +A   +H  W  ++H ++ E R         +PV   
Sbjct  2    QRQMDSAKEVPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNNEERMELRKRSSQFPVTTE 59
Query  78   ---GIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEED-QIYYL--DGLTTQKSAPW 131
               G++  Y++     Y+G FDD TIE IR + DV Y+E D +++ L  D    +K++PW
Sbjct  60   VFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPW 119
Query  132  GLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGGQ- 186
            GL  ISH+   S      Y+Y    GEG   YV+D+G N  H +FEGRA        G  
Sbjct  120  GLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPNGDA 179
Query  187  HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILDGFNWAA---NDIV 242
              D  GHGTH SGT+AGK YG+AKKA + +VKV++   S T S ++ G  +AA   +D V
Sbjct  180  DEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTV 239
Query  243  SKKRTSK------AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPAS 296
               +  K      +A NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+   SPA+
Sbjct  240  QAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAA 299
Query  297  APDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIV 356
            A +A+TV A    + RA FSN+GK  D+FAPG +ILS WIGS  ATNTISGTSMA+PHI 
Sbjct  300  AENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIA 359
Query  357  GLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDV-KGSPNLLAYNG 401
            GL  Y+ +L+   D   AV     K++K     +AT   + DV + + N+LA+NG
Sbjct  360  GLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNG 414

Sequence Alignment: 12. Allergen Name: Cur l 4.0101 Sequence ID: ACF19589

 Score = 101.8 bits 419,  Expect = 7e-23
 Identities = 172/378 45%, Positives = 241/378 63%, Gaps = 40/378 10%
Query  21   APVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIHQRSLERRGAT---GGDLPV 77
            APV  +  A E +P  Y+V FK  + +A   +H  W  ++H ++ + R        DLPV
Sbjct  29   APVLSSTSAKE-VPNSYMVVFKKHVKDAS--KHHDWVQSVHSKNTQERMELRKRSSDLPV 85
Query  78   ------GIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEED-QIYYLDGLT--TQKS 128
                  G++  Y+++ +  Y+G FDD T+E IR + DV Y+E D ++  L G    T+ +
Sbjct  86   SNEVFAGLKHTYELSGLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENN 145
Query  129  APWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAG 184
            +PWGL  ISH+   S      Y+Y    GEG   YV+D+G NVDH +FEGRA        
Sbjct  146  SPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWGKTIPN 205
Query  185  GQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILDGFNWAA---N 239
            G    D  GHGTH SGT+AGK YG+AKKA + +VKV++   S T S ++ G  +AA   +
Sbjct  206  GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVKGVEFAAKSHS 265
Query  240  DIVSKKRTSK------AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTS 293
            + VS  +  K      +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+   S
Sbjct  266  EAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGLHFAVAAGNDNADSCNYS 325
Query  294  PASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATP 353
            PA+A +A+TV A    + RA FSN+GK  D+FAPG +ILS WIGS  ATNTISGTSMA+P
Sbjct  326  PAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSKHATNTISGTSMASP 385
Query  354  HIVGLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDV-KGSPNLLAYNG 401
            HI GL  Y+ +L+   D   AV     K++K     + T   + DV   + N+LA+NG
Sbjct  386  HIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNG 443

Sequence Alignment: 13. Allergen Name: Asp f 18.0101 Sequence ID: Y13338

 Score = 101.1 bits 416,  Expect = 1e-22
 Identities = 176/393 44%, Positives = 250/393 63%, Gaps = 41/393 10%
Query  8    LLLLGAILPAVL------GAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIH 61
            L LL A  P V+       AP+  +  A E +P  YIV FK  ++      H +W  +IH
Sbjct  10   LPLLVAASPVVVDSIHNGAAPILSSMNAKE-VPDSYIVVFKKHVNAESAAAHHSWVQDIH 68
Query  62   QRSLER---RGAT----GGDLPVGIERNYKI-NKFAAYAGSFDDATIEEIRKNEDVAYVE 113
                ER   R  +    G +  +G++  + I   +  Y+G F +  IE++RK+ DV Y+E
Sbjct  69   SAQNERVELRKRSLFGFGEEAYLGLKNTFDIAGSLVGYSGHFHEDVIEQVRKHPDVEYIE 128
Query  114  ED-QIYYLDGLTTQKSAPWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVD 168
            +D +++ ++  T +KSAPWGL  ISH+   S      Y+Y +  GEG  AY +D+G+NVD
Sbjct  129  KDSEVHTMEDPTVEKSAPWGLARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVD 188
Query  169  HEEFEGRASKAYNA-AGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST 227
            H +FEGRA          +  D  GHGTH SGTIAG+ YG+AKKA++ +VKV++   S T
Sbjct  189  HVDFEGRAQWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGSGT 248
Query  228  -SVILDGFNWAANDIVSKKRTSK---------AAINMSLGGGYSKAFNDAVENAFEQGVL 277
             S ++ G  WA    + K + +K         +  NMSLGGG S+ +  AV    E G+ 
Sbjct  249  MSDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTLEAAVNAGVEAGLH 308
Query  278  SVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIG 337
              VAAGN+N+DA   SPA+A + ITV A    + RA FSN+GK  D+FAPG +ILS WIG
Sbjct  309  FAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNYGKCTDIFAPGLNILSTWIG 368
Query  338  SSSATNTISGTSMATPHIVGLSLYLAALE-NLDGPAAVT----KRIKE----LATKDVVK 388
            S  A NTISGTSMA+PHI GL  Y+ +L+ + D   AV     K++K+    +AT+  + 
Sbjct  369  SKHAVNTISGTSMASPHIAGLLAYFVSLQPSKDSAFAVDELTPKKLKKDIIAIATQGALT 428
Query  389  DVKG-SPNLLAYNG 401
            D+   +PNLLA+NG
Sbjct  429  DIPSDTPNLLAWNG 442

Sequence Alignment: 14. Allergen Name: Cla c 9.0101 Sequence ID: ABQ59329

 Score = 99.6 bits 409,  Expect = 3e-22
 Identities = 138/276 50%, Positives = 181/276 65%, Gaps = 25/276 9%
Query  126  QKSAPWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYN 181
            +K+APWGL  ISH+   S      Y+Y    GEG   YVVD+G NVDH +FEGRAS    
Sbjct  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
Query  182  AAGGQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESS-STSVILDGFNWAAN 239
               G    D  GHGTH SGT+AGK YG+AKKA + +VKV++   S S S ++ G  +AA 
Sbjct  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
Query  240  D-----IVSKKRTSK----AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAG 290
                   ++KK   K    +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+ 
Sbjct  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
Query  291  QTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSM 350
              SPA+A +A+TV A   S+ RA FSN+GK  D+FAPG +I S WIGS  A NTISGTSM
Sbjct  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
Query  351  ATPHIVGLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDV-KGSPNLLAYN 400
            A+PH+ GL  YL +L+   D   AV     K++K     +AT   + DV   + N+LA+N
Sbjct  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
Query  401  G 401
            G
Sbjct  314  G 314

Sequence Alignment: 15. Allergen Name: Fus p 9.0101 Sequence ID: A0A0U1Y1N5

 Score = 99.1 bits 407,  Expect = 4e-22
 Identities = 138/280 49%, Positives = 191/280 68%, Gaps = 26/280 9%
Query  121  DGLTTQKSAPWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRA 176
            DG  T++ APWGL  ISH+   +      Y+Y +  GEG  AY+VD+G NVDH +FEGRA
Sbjct  4    DG-ETERQAPWGLARISHRNTLNFGTFNKYLYSSDGGEGVDAYIVDTGTNVDHVDFEGRA 62
Query  177  SKAYNAAGGQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESS-STSVILDGF 234
                    G    D  GHGTH SGT+AGK YG+AKKA++ +VKV++   S S S ++ G 
Sbjct  63   HWGKTIPSGDADEDGNGHGTHCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKGV 122
Query  235  NWAANDIVSKKRTSK---------AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNE 285
             +AA   + +K+ +K         +  NMSLGGG ++A++ AV  A   G+   VAAGN+
Sbjct  123  EFAATSHLEQKKKAKDGKRKGFKGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGND 182
Query  286  NSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTI 345
            N+DA   SPA+A + +TV A    ++RA FSN+GK  D+FAPG +I S WIGS  A NTI
Sbjct  183  NADACNYSPAAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNTI 242
Query  346  SGTSMATPHIVGLSLYLAALENLDGP----AAVT-KRIKE----LATKDVVKDVKG-SPN 395
            SGTSMA+PHI GL  Y  +L+  +      A++T K++KE    +AT+D + D+   +PN
Sbjct  243  SGTSMASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALSDIPSDTPN 302
Query  396  LLAYNG 401
            LLA+NG
Sbjct  303  LLAWNG 308

Sequence Alignment: 16. Allergen Name: Cla h 9.0101 Sequence ID: AAX14379

 Score = 98.2 bits 403,  Expect = 1e-21
 Identities = 170/380 44%, Positives = 238/380 62%, Gaps = 37/380 9%
Query  21   APVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNIHQRS------LERRGATG-- 72
            AP+     A E +   Y++ FK  + +    EH  W  ++H+++      L +R  +   
Sbjct  29   APIISASNAKE-IADNYMIKFKDHVTQNLAAEHHGWVQDLHEKTQVAKTELRKRSQSPMV 87
Query  73   GDLPVGIERNYKI-NKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYLDGLTTQ--KSA 129
             D+  G++  Y I   +  YAG FD+  IE+IR++ DV  VE DQ  ++ G  ++  K+A
Sbjct  88   DDIFNGLKHTYNIAGGLMGYAGHFDEDVIEQIRRHPDVELVERDQEVHVLGSESEVEKNA 147
Query  130  PWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAGG 185
            PWGL  ISH+   S      Y+Y    GEG   YVVD+G NVDH +FEGRAS       G
Sbjct  148  PWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKTIPQG 207
Query  186  Q-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESS-STSVILDGFNWAAND--- 240
                D  GHGTH SGT+AGK YG+AKKA + +VKV++   S S S ++ G  +AA     
Sbjct  208  DADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAESHLE 267
Query  241  --IVSKKRTSK----AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSP 294
               ++KK   K    +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+   SP
Sbjct  268  QVSITKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSCNYSP 327
Query  295  ASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPH 354
            A+A +A+TV A   ++ RA FSN+GK  D+FAPG +I S WIGS  A NTISGTSMA+PH
Sbjct  328  AAAENAVTVGASTLADERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSMASPH 387
Query  355  IVGLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDV-KGSPNLLAYNG 401
            + GL  YL +L+   D   AV     K++K     +AT   + DV   + N+LA+NG
Sbjct  388  VAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWNG 444

Sequence Alignment: 17. Allergen Name: Cuc m 1 Sequence ID: BAA06905

 Score = 39.5 bits 146,  Expect = 0.0006
 Identities = 63/238 26%, Positives = 113/238 47%, Gaps = 32/238 13%
Query  123  LTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNA 182
            +TT   +PW L S++        ++     G G        GV+++   F+   ++ Y  
Sbjct  313  FTTASLSPW-LLSVA-ASTMDRKFVTQVQIGNGQSF----QGVSIN--TFD---NQYYPL 361
Query  183  AGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESS-STSVILDGFNWAANDI 241
              G+ + + G     S     K+       ++L  K+   E+S      +  ++ AA  +
Sbjct  362  VSGRDIPNTGFDKSTSRFCTDKSVN----PNLLKGKIVVCEASFGPHEFFKSLDGAAG-V 416
Query  242  VSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDAI 301
            +    T   A +  L        ND +  A  + + S+ + G     +     ASAP  +
Sbjct  417  LMTSNTRDYADSYPLPSSVLDP-NDLL--ATLRYIYSIRSPGATIFKSTTILNASAP--V 471
Query  302  TVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAW-----IGS---SSATNTISGTSMATP 353
             V+   +  NRA+  +  K  D+  PG +IL+AW     +G    ++  N ISGTSM+ P
Sbjct  472  VVSFSSRGPNRAT-KDVIKP-DISGPGVEILAAWPSVAPVGGIRRNTLFNIISGTSMSCP 529
Query  354  HIVGLSLYLAALENLDGPAAVTKRIKELAT 383
            HI G++ Y+        PAA+   +   A+
Sbjct  530  HITGIATYVKTYNPTWSPAAIKSALMTTAS 559

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.