The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSR
LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF
PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK
ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAG
QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST
MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN
PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM
QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH
KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA
KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSAS
SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS
SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR
SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS
KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP
VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQA
VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM
LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL
QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF
LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH
NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA
KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK
TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA49139 Gal d vitellogenin 1852 12065 2756.1 0
CAA31942 Gal d vitellogenin 1850 12011 2743.8 0
P87498 gal d 6.0101 1912 2893 665.3 3e-191
P87498 Gal d 6.0101 1912 2893
D5MU14 Onc k 5.0101 193 464 112.4 8.3e-26
CAA25027 Gal d vitellogenin 81 383 98.9 4.2e-22
AAC61261 Asp f 16 427 157 42.0 0.0003
AAM21322 Der p 14.0101 1662 157 41.7 0.0014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gal d vitellogenin Sequence ID: AAA49139

 Score = 2756.1 bits 12065,  Expect = 0
 Identities = 1852/1852 100%, Positives = 1852/1852 100%, Gaps = 0/1852 0%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
Sbjct  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
Sbjct  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
Sbjct  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
Sbjct  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
Query  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
            VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
Sbjct  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
Query  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
            IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
Sbjct  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
Query  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
            YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
Sbjct  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
Query  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
            TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
Sbjct  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
Query  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
            LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
Sbjct  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
Query  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSR 600
            LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSR
Sbjct  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSR 600
Query  601  LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF 660
            LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF
Sbjct  601  LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF 660
Query  661  PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK 720
            PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK
Sbjct  661  PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK 720
Query  721  ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAG 780
            ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAG
Sbjct  721  ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAG 780
Query  781  QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST 840
            QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST
Sbjct  781  QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST 840
Query  841  MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN 900
            MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN
Sbjct  841  MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN 900
Query  901  PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM 960
            PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM
Sbjct  901  PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM 960
Query  961  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1020
            QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH
Sbjct  961  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1020
Query  1021 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1080
            KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA
Sbjct  1021 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1080
Query  1081 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSAS 1140
            KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSAS
Sbjct  1081 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSAS 1140
Query  1141 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1200
            SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS
Sbjct  1141 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1200
Query  1201 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR 1260
            SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR
Sbjct  1201 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR 1260
Query  1261 SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS 1320
            SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS
Sbjct  1261 SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS 1320
Query  1321 KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP 1380
            KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP
Sbjct  1321 KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP 1380
Query  1381 VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQA 1440
            VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQA
Sbjct  1381 VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQA 1440
Query  1441 VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM 1500
            VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM
Sbjct  1441 VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM 1500
Query  1501 LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL 1560
            LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL
Sbjct  1501 LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL 1560
Query  1561 QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF 1620
            QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF
Sbjct  1561 QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF 1620
Query  1621 LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH 1680
            LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH
Sbjct  1621 LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH 1680
Query  1681 NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA 1740
            NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA
Sbjct  1681 NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA 1740
Query  1741 KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK 1800
            KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK
Sbjct  1741 KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK 1800
Query  1801 TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1852
            TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
Sbjct  1801 TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1852

Sequence Alignment: 2. Allergen Name: Gal d vitellogenin Sequence ID: CAA31942

 Score = 2743.8 bits 12011,  Expect = 0
 Identities = 1846/1850 99%, Positives = 1848/1850 99%, Gaps = 2/1850 0%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
Sbjct  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
Sbjct  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
Sbjct  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
Sbjct  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
Query  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
            VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
Sbjct  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
Query  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
            IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
Sbjct  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
Query  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
            YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
Sbjct  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
Query  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
            TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
Sbjct  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
Query  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
            LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
Sbjct  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
Query  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSR 600
            LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKES  NMQVASFVYSHMKSLSKSR
Sbjct  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKES--NMQVASFVYSHMKSLSKSR 598
Query  601  LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF 660
            LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF
Sbjct  599  LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF 658
Query  661  PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK 720
            PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK
Sbjct  659  PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK 718
Query  721  ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAG 780
            ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQI NSIAG
Sbjct  719  ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAG 778
Query  781  QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST 840
            QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST
Sbjct  779  QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST 838
Query  841  MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN 900
            MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN
Sbjct  839  MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN 898
Query  901  PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM 960
            PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM
Sbjct  899  PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM 958
Query  961  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1020
            QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH
Sbjct  959  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1018
Query  1021 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1080
            KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA
Sbjct  1019 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1078
Query  1081 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSAS 1140
            KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSS+S
Sbjct  1079 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSS 1138
Query  1141 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1200
            SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS
Sbjct  1139 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1198
Query  1201 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR 1260
            SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR
Sbjct  1199 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR 1258
Query  1261 SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS 1320
            SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS
Sbjct  1259 SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS 1318
Query  1321 KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP 1380
            KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP
Sbjct  1319 KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP 1378
Query  1381 VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQA 1440
            VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNA +A
Sbjct  1379 VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKA 1438
Query  1441 VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM 1500
            VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM
Sbjct  1439 VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM 1498
Query  1501 LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL 1560
            LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL
Sbjct  1499 LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL 1558
Query  1561 QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF 1620
            QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF
Sbjct  1559 QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF 1618
Query  1621 LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH 1680
            LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH
Sbjct  1619 LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH 1678
Query  1681 NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA 1740
            NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA
Sbjct  1679 NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA 1738
Query  1741 KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK 1800
            KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK
Sbjct  1739 KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK 1798
Query  1801 TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1852
            TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
Sbjct  1799 TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1850

Sequence Alignment: 3. Allergen Name: gal d 6.0101 Sequence ID: P87498

 Score = 665.3 bits 2893,  Expect = 3e-191
 Identities = 672/1830 36%, Positives = 1107/1830 60%, Gaps = 103/1830 5%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRG+I ALVLTLVGSQ ++  P F   + Y YNYE  +++G+ ++ L + G+R+ S++EI
Sbjct  1    MRGLISALVLTLVGSQHLNYQPDFGENKVYTYNYESILFSGIPEKGLARTGIRIRSEVEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SG+     L+++ S +  EYNG+WP   F+RS K+TQ ++  ++   KFEYS+G +GN+ 
Sbjct  61   SGIGPKLCLIRIHSIEAAEYNGIWPTSSFSRSLKLTQALTGQLSIPIKFEYSNGHVGNLM 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            AP+   D  +NI RGILN++++++KK Q+ Y +QEAGIGGIC+  Y IQE++K + + VT
Sbjct  121  APDSVSDDGLNIYRGILNILELSLKKMQHSYSIQEAGIGGICNTTYAIQENKKANLVDVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            ++ DLN+C+EKVQ   G AY  PC     + + ++ T  ++YK+K + +  +IT     +
Sbjct  181  KSKDLNSCEEKVQVVTGSAYTQPCQTCQQRNKNSRATATYNYKIKYTHNEAVITQAEVEE 240
Query  241  VYQISPFNEPTG-VAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQ 299
            V+Q +PF+E TG  A++EARQ+L L+EV+ +    P    Q  GSL+Y+F + L Q+P++
Sbjct  241  VHQFTPFHEITGGNAIVEARQKLALIEVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVH 300
Query  300  LIKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKP 359
            L K K+ E++I E LQ +V    + +  D   + L++++L R AN +N ES+W+Q S +P
Sbjct  301  LFKIKDVERQIEERLQDLVETTYEQLPSDAPAKALKLMHLLRAANEENYESVWKQFSSRP 360
Query  360  RYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADL 419
             YRR+LL  + A+ +  +L+FL++++   +L   +   TV + LH     +  +  A  +
Sbjct  361  AYRRYLLDLLPAAASHRSLRFLRHKMERQELTNWEIAQTVLVALHSSSPTQEVMEEATLI 420
Query  420  MTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKL 479
            +     + + VL++V  L Y+S+ ++ CS   +C  E LQ  H +A EA+ +   +++ L
Sbjct  421  VKKHCPRSSSVLRKVCLLSYASLCHKRCSSPYSC-SECLQVFHVFAGEALGKSNIEEVLL 479
Query  480  ALKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQ 539
            ALK +GN+G PAS+K I KFLP  ++ A+++P+ ++  A+ ALK I  +DP+ VQ   ++
Sbjct  480  ALKALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPQMVQAITLE 539
Query  540  ILADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKS 599
            I+ ++ + P +RM+A  V++ET+P L ++  + +  +KE   +MQVASF+YSH+++L +S
Sbjct  540  IFLNHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKE--PSMQVASFIYSHLRALGRS 597
Query  600  RLPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTM 659
              P +  ++SAC +A++ LSPK+D   Y++SKV R   + +    G   + FV+N+  ++
Sbjct  598  TAPDLQMMASACRMAVRALSPKFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAGSL 657
Query  660  FPSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGW 719
             P+  +S+L  +  G VAD +EVGI  EGL ++ ++   P  ++ T    +E+ K L  W
Sbjct  658  IPTMAVSQLRTHFLGRVADPIEVGIAAEGLQEMFVRGYSPDKDWETNYDFREILKKLSDW 717
Query  720  KELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIA 779
            K LP + P+ S YLK++GQE+ F  ++K+ LQ V++    P ++  +I+R+ + +   I 
Sbjct  718  KALPRDKPFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPSIRRLISSLQTGIG 777
Query  780  GQWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLES 839
             QWT+ + + E+R +VP+C+G+P+E   Y +++ + A +V+ ++TP    DFRL++LL S
Sbjct  778  RQWTKALLLSEIRCIVPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDFRLTELLNS 837
Query  840  TMQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIET 899
             +++RS +  S+  H    +G+NT   Q  +E + +V   +P+   A I +K K++K E 
Sbjct  838  NVRLRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMKEKSIKAEI 897
Query  900  NPCREETEIVVGRHKAFAVSRNIGELGVEKRTSIL-PEDAPLDVTEEPFQTSERASREHF 958
             PC+EET +++   K FAV+RNI +L   K T +L PE  P D+ +  F  S+ AS E  
Sbjct  898  PPCKEETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVP-DIMKMSFD-SDSASGETD 955
Query  959  AMQGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTY 1018
             ++   S+    S +S      S+GK    + +C      G Q+C  ++S  A+FI+N  
Sbjct  956  NIRDRQSVEDVSSGNSFSFGHPSSGKEPFIQSMCSNASTFGVQVCIEKKSVHAAFIRNVP 1015
Query  1019 LHKLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDI 1078
            L+  IGEH  ++ + PV++D  I+KIQ+ IQAG +A  +++  V  E  E  ESS  +++
Sbjct  1016 LYNAIGEHALRMSFKPVYSDVPIEKIQVTIQAGDQAPTKMVRLVTFEDPERQESS-RKEV 1074
Query  1079 QAKLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSS 1138
              ++K+IL         + T +   R S+  ++  +      ++ TS+ SSS S    S 
Sbjct  1075 MKRVKKIL---------DDTDNQATRNSRSSSSSASSISESSESTTSTPSSSDSDNRASQ 1125
Query  1139 ASSSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSS 1198
                 +  +R+   +E++      + +  +SSSS SS SS+S   SSS+SS+SS  SSSS
Sbjct  1126 GDPQINLKSRQSKANEKKFYPFGDSSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSS 1185
Query  1199 SSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS 1258
            SSSSSSSS  S SSS SS +++SSSSS+   SSSS S+S+SK SSSSSS +S +  K+  
Sbjct  1186 SSSSSSSSSKSKSSSRSSKSNRSSSSSNSKDSSSSSSKSNSKGSSSSSSKASGTRQKAKK 1245
Query  1259 -SRSSS-------------------SSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSH-- 1296
             S+++S                   + S SSS    S +S   + S+SSSS S  VSH  
Sbjct  1246 QSKTTSFPHASAAEGERSVHEQKQETQSSSSSSSRASSNSRSTSSSTSSSSESSGVSHRQ 1305
Query  1297 --HSHEHHSGHLEDDSSSSSSSSVLSKIWGRH--EIYQYRFRSAHRQEFPKRKLPGDRAT 1352
              +  E  +  ++   +S SS  + ++ W  +  ++Y+ RFRSAH +     +     ++
Sbjct  1306 WKQDREAETKRVKSQFNSHSSYDIPNE-WETYLPKVYRLRFRSAHTHWHSGHRTSSSSSS 1364
Query  1353 SRY-------------SSTRSSH------------------------DTSRAASW---P- 1371
            S               SS+R SH                         TSRAAS    P 
Sbjct  1365 SSSESGSSHSNSSSSDSSSRRSHMSDSSSSSSSHRHGEKAAHSSRRSPTSRAASAHHRPG 1424
Query  1372 -------KFLGDIKTPVLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSS 1424
                    FLGD+  P +    + + ++ +  G Q   Y  +D+ +  VQ+ V  L +++
Sbjct  1425 SSLTRERNFLGDVIPPGITIVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVVVQLAETN 1484
Query  1425 KWKLCADASVRNAP-QAVAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNV 1483
             WK CADA +   P +A A ++WG +CRDY+++    TG+ A   A Q+K++W  +PS +
Sbjct  1485 -WKACADAVI--LPLKAQARMRWGKECRDYRIAALATTGQMARKLAVQLKVQWGIIPSWI 1541
Query  1484 RSVVEWFYEFVPGAAFMLGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAV 1543
            +     +  +VPG A++LGFSE   +NPSR+  +    TSPR+ D V+K+P + LY + +
Sbjct  1542 KKTSTALMRYVPGVALVLGFSEAHQRNPSRELIVRAVATSPRSIDTVIKVPGVTLYYQGL 1601
Query  1544 RLPLSLPVGPRIPASELQP-PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSM 1602
            R+P++L +G    + E +    WN + E  S + +  ++ C VS    KTF+ + F  S 
Sbjct  1602 RVPFTLALGASSSSYETRDITAWNFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSF 1661
Query  1603 PANCYHILVQDCSSELKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAE 1662
              +C  ++ QDC+   KF++  +     +  + ++I   S  I + P      L+    E
Sbjct  1662 NKSCNVVVAQDCTEHPKFIITTRKVDHQSLSREVHINTSSANITICPAADSSLLVTCNKE 1721
Query  1663 SPTANISLISAGA--SLWIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGI 1720
            S  ++ S +S     ++ I+   +   + AP HG+  + FDG+ + + V  WM GKTCG+
Sbjct  1722 SVLSD-SGVSEYEKDNIKIYKNGKTVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGV 1780
Query  1721 CGKYDAECEQEYRMPNGYLAKNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVD 1780
            CG  D E   E  MPN  LA +  +F HSW+L E  C G CKL+R +VKL +   + G +
Sbjct  1781 CGNNDREKHNELLMPNHKLAHSCSAFVHSWVLLEETCSGGCKLQRRYVKLNRNPTIDGEE 1840
Query  1781 SKCYSTEPVLRCAKGCSATKTTPVTVGFHCLPADSANSLTDKQMKYDQKS--EDMQDTVD 1838
            S CYS +PVL+C K C+  + T V VGFHC+P  +A SL + Q   D+KS  ED+ ++VD
Sbjct  1841 STCYSVDPVLKCMKDCTPIEKTSVKVGFHCFPKATAVSLLEWQRSSDKKSASEDVVESVD 1900
Query  1839 AHTTCSCENEECS 1851
            A   C+C  + CS
Sbjct  1901 ADIDCTCTGD-CS 1912

Sequence Alignment: 4. Allergen Name: Gal Sequence ID: P87498

 Score = 665.3 bits 2893,  Expect = 3e-191
 Identities = 672/1830 36%, Positives = 1107/1830 60%, Gaps = 103/1830 5%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRG+I ALVLTLVGSQ ++  P F   + Y YNYE  +++G+ ++ L + G+R+ S++EI
Sbjct  1    MRGLISALVLTLVGSQHLNYQPDFGENKVYTYNYESILFSGIPEKGLARTGIRIRSEVEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SG+     L+++ S +  EYNG+WP   F+RS K+TQ ++  ++   KFEYS+G +GN+ 
Sbjct  61   SGIGPKLCLIRIHSIEAAEYNGIWPTSSFSRSLKLTQALTGQLSIPIKFEYSNGHVGNLM 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            AP+   D  +NI RGILN++++++KK Q+ Y +QEAGIGGIC+  Y IQE++K + + VT
Sbjct  121  APDSVSDDGLNIYRGILNILELSLKKMQHSYSIQEAGIGGICNTTYAIQENKKANLVDVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            ++ DLN+C+EKVQ   G AY  PC     + + ++ T  ++YK+K + +  +IT     +
Sbjct  181  KSKDLNSCEEKVQVVTGSAYTQPCQTCQQRNKNSRATATYNYKIKYTHNEAVITQAEVEE 240
Query  241  VYQISPFNEPTG-VAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQ 299
            V+Q +PF+E TG  A++EARQ+L L+EV+ +    P    Q  GSL+Y+F + L Q+P++
Sbjct  241  VHQFTPFHEITGGNAIVEARQKLALIEVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVH 300
Query  300  LIKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKP 359
            L K K+ E++I E LQ +V    + +  D   + L++++L R AN +N ES+W+Q S +P
Sbjct  301  LFKIKDVERQIEERLQDLVETTYEQLPSDAPAKALKLMHLLRAANEENYESVWKQFSSRP 360
Query  360  RYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADL 419
             YRR+LL  + A+ +  +L+FL++++   +L   +   TV + LH     +  +  A  +
Sbjct  361  AYRRYLLDLLPAAASHRSLRFLRHKMERQELTNWEIAQTVLVALHSSSPTQEVMEEATLI 420
Query  420  MTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKL 479
            +     + + VL++V  L Y+S+ ++ CS   +C  E LQ  H +A EA+ +   +++ L
Sbjct  421  VKKHCPRSSSVLRKVCLLSYASLCHKRCSSPYSC-SECLQVFHVFAGEALGKSNIEEVLL 479
Query  480  ALKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQ 539
            ALK +GN+G PAS+K I KFLP  ++ A+++P+ ++  A+ ALK I  +DP+ VQ   ++
Sbjct  480  ALKALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPQMVQAITLE 539
Query  540  ILADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKS 599
            I+ ++ + P +RM+A  V++ET+P L ++  + +  +KE   +MQVASF+YSH+++L +S
Sbjct  540  IFLNHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKE--PSMQVASFIYSHLRALGRS 597
Query  600  RLPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTM 659
              P +  ++SAC +A++ LSPK+D   Y++SKV R   + +    G   + FV+N+  ++
Sbjct  598  TAPDLQMMASACRMAVRALSPKFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAGSL 657
Query  660  FPSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGW 719
             P+  +S+L  +  G VAD +EVGI  EGL ++ ++   P  ++ T    +E+ K L  W
Sbjct  658  IPTMAVSQLRTHFLGRVADPIEVGIAAEGLQEMFVRGYSPDKDWETNYDFREILKKLSDW 717
Query  720  KELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIA 779
            K LP + P+ S YLK++GQE+ F  ++K+ LQ V++    P ++  +I+R+ + +   I 
Sbjct  718  KALPRDKPFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPSIRRLISSLQTGIG 777
Query  780  GQWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLES 839
             QWT+ + + E+R +VP+C+G+P+E   Y +++ + A +V+ ++TP    DFRL++LL S
Sbjct  778  RQWTKALLLSEIRCIVPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDFRLTELLNS 837
Query  840  TMQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIET 899
             +++RS +  S+  H    +G+NT   Q  +E + +V   +P+   A I +K K++K E 
Sbjct  838  NVRLRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMKEKSIKAEI 897
Query  900  NPCREETEIVVGRHKAFAVSRNIGELGVEKRTSIL-PEDAPLDVTEEPFQTSERASREHF 958
             PC+EET +++   K FAV+RNI +L   K T +L PE  P D+ +  F  S+ AS E  
Sbjct  898  PPCKEETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVP-DIMKMSFD-SDSASGETD 955
Query  959  AMQGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTY 1018
             ++   S+    S +S      S+GK    + +C      G Q+C  ++S  A+FI+N  
Sbjct  956  NIRDRQSVEDVSSGNSFSFGHPSSGKEPFIQSMCSNASTFGVQVCIEKKSVHAAFIRNVP 1015
Query  1019 LHKLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDI 1078
            L+  IGEH  ++ + PV++D  I+KIQ+ IQAG +A  +++  V  E  E  ESS  +++
Sbjct  1016 LYNAIGEHALRMSFKPVYSDVPIEKIQVTIQAGDQAPTKMVRLVTFEDPERQESS-RKEV 1074
Query  1079 QAKLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSS 1138
              ++K+IL         + T +   R S+  ++  +      ++ TS+ SSS S    S 
Sbjct  1075 MKRVKKIL---------DDTDNQATRNSRSSSSSASSISESSESTTSTPSSSDSDNRASQ 1125
Query  1139 ASSSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSS 1198
                 +  +R+   +E++      + +  +SSSS SS SS+S   SSS+SS+SS  SSSS
Sbjct  1126 GDPQINLKSRQSKANEKKFYPFGDSSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSS 1185
Query  1199 SSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS 1258
            SSSSSSSS  S SSS SS +++SSSSS+   SSSS S+S+SK SSSSSS +S +  K+  
Sbjct  1186 SSSSSSSSSKSKSSSRSSKSNRSSSSSNSKDSSSSSSKSNSKGSSSSSSKASGTRQKAKK 1245
Query  1259 -SRSSS-------------------SSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSH-- 1296
             S+++S                   + S SSS    S +S   + S+SSSS S  VSH  
Sbjct  1246 QSKTTSFPHASAAEGERSVHEQKQETQSSSSSSSRASSNSRSTSSSTSSSSESSGVSHRQ 1305
Query  1297 --HSHEHHSGHLEDDSSSSSSSSVLSKIWGRH--EIYQYRFRSAHRQEFPKRKLPGDRAT 1352
              +  E  +  ++   +S SS  + ++ W  +  ++Y+ RFRSAH +     +     ++
Sbjct  1306 WKQDREAETKRVKSQFNSHSSYDIPNE-WETYLPKVYRLRFRSAHTHWHSGHRTSSSSSS 1364
Query  1353 SRY-------------SSTRSSH------------------------DTSRAASW---P- 1371
            S               SS+R SH                         TSRAAS    P 
Sbjct  1365 SSSESGSSHSNSSSSDSSSRRSHMSDSSSSSSSHRHGEKAAHSSRRSPTSRAASAHHRPG 1424
Query  1372 -------KFLGDIKTPVLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSS 1424
                    FLGD+  P +    + + ++ +  G Q   Y  +D+ +  VQ+ V  L +++
Sbjct  1425 SSLTRERNFLGDVIPPGITIVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVVVQLAETN 1484
Query  1425 KWKLCADASVRNAP-QAVAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNV 1483
             WK CADA +   P +A A ++WG +CRDY+++    TG+ A   A Q+K++W  +PS +
Sbjct  1485 -WKACADAVI--LPLKAQARMRWGKECRDYRIAALATTGQMARKLAVQLKVQWGIIPSWI 1541
Query  1484 RSVVEWFYEFVPGAAFMLGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAV 1543
            +     +  +VPG A++LGFSE   +NPSR+  +    TSPR+ D V+K+P + LY + +
Sbjct  1542 KKTSTALMRYVPGVALVLGFSEAHQRNPSRELIVRAVATSPRSIDTVIKVPGVTLYYQGL 1601
Query  1544 RLPLSLPVGPRIPASELQP-PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSM 1602
            R+P++L +G    + E +    WN + E  S + +  ++ C VS    KTF+ + F  S 
Sbjct  1602 RVPFTLALGASSSSYETRDITAWNFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSF 1661
Query  1603 PANCYHILVQDCSSELKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAE 1662
              +C  ++ QDC+   KF++  +     +  + ++I   S  I + P      L+    E
Sbjct  1662 NKSCNVVVAQDCTEHPKFIITTRKVDHQSLSREVHINTSSANITICPAADSSLLVTCNKE 1721
Query  1663 SPTANISLISAGA--SLWIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGI 1720
            S  ++ S +S     ++ I+   +   + AP HG+  + FDG+ + + V  WM GKTCG+
Sbjct  1722 SVLSD-SGVSEYEKDNIKIYKNGKTVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGV 1780
Query  1721 CGKYDAECEQEYRMPNGYLAKNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVD 1780
            CG  D E   E  MPN  LA +  +F HSW+L E  C G CKL+R +VKL +   + G +
Sbjct  1781 CGNNDREKHNELLMPNHKLAHSCSAFVHSWVLLEETCSGGCKLQRRYVKLNRNPTIDGEE 1840
Query  1781 SKCYSTEPVLRCAKGCSATKTTPVTVGFHCLPADSANSLTDKQMKYDQKS--EDMQDTVD 1838
            S CYS +PVL+C K C+  + T V VGFHC+P  +A SL + Q   D+KS  ED+ ++VD
Sbjct  1841 STCYSVDPVLKCMKDCTPIEKTSVKVGFHCFPKATAVSLLEWQRSSDKKSASEDVVESVD 1900
Query  1839 AHTTCSCENEECS 1851
            A   C+C  + CS
Sbjct  1901 ADIDCTCTGD-CS 1912

Sequence Alignment: 5. Allergen Name: Onc k 5.0101 Sequence ID: D5MU14

 Score = 112.4 bits 464,  Expect = 8e-26
 Identities = 70/191 36%, Positives = 111/191 58%, Gaps = 1/191 0%
Query  1558 SELQPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSE 1617
            ++L P   N+  +      E    +CS+  + + TFN  K+  +MP +CY++L QDC+ E
Sbjct  3    TDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIE 62
Query  1618 LKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASL 1677
            LKF+V++K    A+    IN+KI   ++D++  +  V + V+  E    N+       S+
Sbjct  63   LKFMVLLKK-DHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSI 121
Query  1678 WIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNG 1737
             I  + +G +L A  HG+ ++YFD  +  I+V  WM G+TCG+CGK D E  QEYR P+G
Sbjct  122  MIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSG 181
Query  1738 YLAKNAVSFGHS 1749
             L K++VSF HS
Sbjct  182  RLTKSSVSFAHS 193

Sequence Alignment: 6. Allergen Name: Gal d vitellogenin Sequence ID: CAA25027

 Score = 98.9 bits 383,  Expect = 4e-22
 Identities = 71/71 100%, Positives = 71/71 100%, Gaps = 10/71 14%
Query  1    MRGIILALVLTLV----------GSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKA 50
            MRGIILALVLTLV          GSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKA
Sbjct  1    MRGIILALVLTLVAHVVFLSLFVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKA 60
Query  51   GVRLSSKLEISGLPENAYLLK 71
            GVRLSSKLEISGLPENAYLLK
Sbjct  61   GVRLSSKLEISGLPENAYLLK 81

Sequence Alignment: 7. Allergen Name: Asp f 16 Sequence ID: AAC61261

 Score = 42.0 bits 157,  Expect = 0.0003
 Identities = 40/127 31%, Positives = 73/127 57%, Gaps = 11/127 8%
Query  1182 KRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKS 1241
            +R SS SS +S  +S++SS+SS+SS++ S+S+ ++S   + + S  SS S+S S +   +
Sbjct  268  RRYSSSSSVTSSTTSTASSASSTSSKTPSTSTLATSTKATPTPSGTSSGSNSSSSAEPTT 327
Query  1242 SSSSSSSSSSSSSK-------SSSSRSSSSSSKSSSHHSHSHHSGHLNGSSSS----SSS 1290
            +  S SS++ S  +        SS+ SS+S+  S++       +G + GS +     S+ 
Sbjct  328  TGGSGSSNTGSWLRLRLWLWLYSSTGSSTSAGASATPELSQGAAGSIKGSVTPALWCSAP 387
Query  1291 SRSVSHHSHEHHSGHLED 1308
            S    H  +    G + D
Sbjct  388  SLPCWHSKQNDDFGLMHD 405

Sequence Alignment: 8. Allergen Name: Der p 14.0101 Sequence ID: AAM21322

 Score = 41.7 bits 157,  Expect = 0.001
 Identities = 142/631 22%, Positives = 313/631 49%, Gaps = 94/631 14%
Query  107  FKFEYSSGRIGNIYAPEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARY 166
            F F Y +GRI  +   +D  D  +N+ + I++ +Q       NV + +E    G C   Y
Sbjct  96   FAFGYFNGRILGVCPADDDQDWSLNVKKAIVSSLQAL--SDGNVEKAEEIDFSGRCPTEY 153
Query  167  VIQEDRKNSRIYVTRTVDLNNCQEK---VQKSIGMAYIYPCPVDVMKERLTKGTTAFSYK 223
                 + ++ + + +  DLN C ++   ++++   A       ++M+  +    + +S +
Sbjct  154  RKIRSQDDNTVVIEKRKDLNLCDDRRIDLRQTPDQALGQL--KELMRHYMHPMDSDLSCR 211
Query  224  LKQSDSGTLITDVSSRQVYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYG 283
            +   D      D   R+V  +   N+P  ++ ++      ++  +++ G A D+   N  
Sbjct  212  MTLKDKVVTEVDCEERHVL-VHRSNKPVHMSYVK------MMLKQNKDGVAADLGPTNAQ 264
Query  284  SLRYRFPAVLPQMPLQLIKTKNP-EQRIVETLQHIVLN-NQQDFHDDVSYRFLEVVQLCR 341
              R       P + +   K KNP E  +VE L+ +     +     + S+ F ++V   R
Sbjct  265  PKR-------PYLSFDH-KHKNPTETDVVEVLKKLCSEITEPQASIETSFTFQKLVDKLR 316
Query  342  IANADNLESIWRQVSDK--P----RYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQT 395
              +A+   S+   V     P    R R  +L A + + +  +++ L     N +L+  ++
Sbjct  317  YLSAEETASVDESVKTSVCPAHAHRLRELFLDASAFAASDGSIRTLVKAHENQELSITRS 376
Query  396  LLTVSLTLHLLQA--DEHTLPIAADLMTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSAC 453
              T  +T+  ++A  ++ T+ +   ++ S +  + P+L     LG+S +V RYC +T+ C
Sbjct  377  --TALFTVAAIKAAPNKETVQVLLPVIASEKTIR-PML-----LGFSVLVRRYCEKTNDC 428
Query  454  PKEA-LQPIHD--LADEAISRGREDKMKL--ALKCIGNMGEPASLKRILKFLPISSSSAA 508
               + ++   D  LA  A++R   ++M +  AL+ + N+        +     I  S+ A
Sbjct  429  ATNSGVKDARDAYLARLAVARDASERMTIVRALENL-NVNTDGVDNMVNAMDEIIKSTDA 487
Query  509  DIPVHIQIDAITALKKIAWKDPKTVQGYLIQILADQSLPPEVRMMACAVIFETRPALALI 568
            + P  ++  A+ AL      D   +  Y   ++ D+S+P E R+ A   + +    ++ I
Sbjct  488  E-PA-MRAAAVNALPN----DASHMDRYK-SLVMDESMPNEARIAAFQKMMKN-GGMSHI 539
Query  569  TTIANVAMKESKTNMQVASFVYSHMKSLSKSRLPFMYNISSACNIALKLLSPKLD-SMSY 627
              +  V  +  K      ++V +++ +L KS+   +   +   ++ L    PK +  ++ 
Sbjct  540  KDLFAVKGECMK------NYVLTYVDNLKKSKND-LRRQTVGEDVELPE-KPKREIGITR 591
Query  628  RYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPSAIISKLMANSAGSVADLVEVGIRVE 687
              ++     T+  +     T E    N  R+     I  +L+ +    + +LVE  +   
Sbjct  592  NIAREYGPYTFEYDVIYPETHE----NVTRS-----INGRLIRSKNDQLKELVEFQVTQS 642
Query  688  GLADVIMKRNIPFAEYPTYKQI----KELGKALQGWKELPTETPLVSAYLKILGQEVAFI 743
            G+ D  +   + + E  +++ +    +++ K L   ++   +   +   ++I G+ V F 
Sbjct  643  GF-DRELNNAMSLLEKKSFQSVMQFLRDMLKMLSQIRKNADDNHHMKITVQINGKNVYFT 701
Query  744  NI---NKELLQQVMKTVVEPADRNAAIKRIANQILNSIAGQWTQPVWMGELRYVVPSCLG 800
            ++    K++ + +MK V +  +     + I   +L+S              + V+P+  G
Sbjct  702  DLFQDTKKMKELLMKRVEKIINDKKVDRSIGGVLLDS--------------KLVLPTITG 747
Query  801  LPLEY 805
            LPL Y
Sbjct  748  LPLMY 752

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.