The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLP
FMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPS
AIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKEL
PTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQW
TQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQ
IRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPC
REETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQG
PDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKL
IGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKL
KRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSSSS
ASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSS
SSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSS
SSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKI
WGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVL
AAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKAVA
YVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLG
FSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQP
PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLV
MMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNE
NQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKN
AVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTT
PVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA31942 Gal d vitellogenin 1850 12055 2753.8 0
AAA49139 Gal d vitellogenin 1852 12011 2743.8 0
P87498 gal d 6.0101 1912 2909 669.0 2.4e-192
P87498 Gal d 6.0101 1912 2909
D5MU14 Onc k 5.0101 193 464 112.4 8.3e-26
CAA25027 Gal d vitellogenin 81 383 98.9 4.2e-22
AAC61261 Asp f 16 427 157 42.0 0.0003
AAM21322 Der p 14.0101 1662 165 43.5 0.0004
AAF14270 Eur m 14 1668 145 39.0 0.0094
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gal d vitellogenin Sequence ID: CAA31942

 Score = 2753.8 bits 12055,  Expect = 0
 Identities = 1850/1850 100%, Positives = 1850/1850 100%, Gaps = 0/1850 0%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
Sbjct  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
Sbjct  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
Sbjct  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
Sbjct  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
Query  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
            VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
Sbjct  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
Query  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
            IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
Sbjct  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
Query  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
            YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
Sbjct  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
Query  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
            TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
Sbjct  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
Query  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
            LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
Sbjct  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
Query  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLP 600
            LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLP
Sbjct  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLP 600
Query  601  FMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPS 660
            FMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPS
Sbjct  601  FMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPS 660
Query  661  AIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKEL 720
            AIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKEL
Sbjct  661  AIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKEL 720
Query  721  PTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQW 780
            PTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQW
Sbjct  721  PTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQW 780
Query  781  TQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQ 840
            TQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQ
Sbjct  781  TQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQ 840
Query  841  IRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPC 900
            IRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPC
Sbjct  841  IRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPC 900
Query  901  REETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQG 960
            REETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQG
Sbjct  901  REETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQG 960
Query  961  PDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKL 1020
            PDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKL
Sbjct  961  PDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKL 1020
Query  1021 IGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKL 1080
            IGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKL
Sbjct  1021 IGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKL 1080
Query  1081 KRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSSSS 1140
            KRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSSSS
Sbjct  1081 KRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSSSS 1140
Query  1141 ASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSS 1200
            ASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSS
Sbjct  1141 ASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSS 1200
Query  1201 SSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSS 1260
            SSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSS
Sbjct  1201 SSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSS 1260
Query  1261 SSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKI 1320
            SSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKI
Sbjct  1261 SSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKI 1320
Query  1321 WGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVL 1380
            WGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVL
Sbjct  1321 WGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVL 1380
Query  1381 AAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKAVA 1440
            AAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKAVA
Sbjct  1381 AAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKAVA 1440
Query  1441 YVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLG 1500
            YVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLG
Sbjct  1441 YVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLG 1500
Query  1501 FSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQP 1560
            FSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQP
Sbjct  1501 FSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQP 1560
Query  1561 PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLV 1620
            PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLV
Sbjct  1561 PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLV 1620
Query  1621 MMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNE 1680
            MMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNE
Sbjct  1621 MMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNE 1680
Query  1681 NQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKN 1740
            NQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKN
Sbjct  1681 NQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKN 1740
Query  1741 AVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTT 1800
            AVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTT
Sbjct  1741 AVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTT 1800
Query  1801 PVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1850
            PVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
Sbjct  1801 PVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1850

Sequence Alignment: 2. Allergen Name: Gal d vitellogenin Sequence ID: AAA49139

 Score = 2743.8 bits 12011,  Expect = 0
 Identities = 1846/1850 99%, Positives = 1848/1850 99%, Gaps = 2/1850 0%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
Sbjct  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
Sbjct  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
Sbjct  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
Sbjct  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
Query  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
            VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
Sbjct  241  VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL 300
Query  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
            IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
Sbjct  301  IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR 360
Query  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
            YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
Sbjct  361  YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM 420
Query  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
            TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
Sbjct  421  TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA 480
Query  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
            LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
Sbjct  481  LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI 540
Query  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKES--NMQVASFVYSHMKSLSKSR 598
            LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKES  NMQVASFVYSHMKSLSKSR
Sbjct  541  LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESKTNMQVASFVYSHMKSLSKSR 600
Query  599  LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF 658
            LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF
Sbjct  601  LPFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMF 660
Query  659  PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK 718
            PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK
Sbjct  661  PSAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWK 720
Query  719  ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAG 778
            ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQI NSIAG
Sbjct  721  ELPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQILNSIAG 780
Query  779  QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST 838
            QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST
Sbjct  781  QWTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLEST 840
Query  839  MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN 898
            MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN
Sbjct  841  MQIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETN 900
Query  899  PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM 958
            PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM
Sbjct  901  PCREETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAM 960
Query  959  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1018
            QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH
Sbjct  961  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1020
Query  1019 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1078
            KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA
Sbjct  1021 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1080
Query  1079 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSS 1138
            KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSS+S
Sbjct  1081 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSAS 1140
Query  1139 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1198
            SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS
Sbjct  1141 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1200
Query  1199 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR 1258
            SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR
Sbjct  1201 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSR 1260
Query  1259 SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS 1318
            SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS
Sbjct  1261 SSSSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLS 1320
Query  1319 KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP 1378
            KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP
Sbjct  1321 KIWGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTP 1380
Query  1379 VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKA 1438
            VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNA +A
Sbjct  1381 VLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAPQA 1440
Query  1439 VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM 1498
            VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM
Sbjct  1441 VAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFM 1500
Query  1499 LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL 1558
            LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL
Sbjct  1501 LGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASEL 1560
Query  1559 QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF 1618
            QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF
Sbjct  1561 QPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKF 1620
Query  1619 LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH 1678
            LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH
Sbjct  1621 LVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIH 1680
Query  1679 NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA 1738
            NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA
Sbjct  1681 NENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLA 1740
Query  1739 KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK 1798
            KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK
Sbjct  1741 KNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATK 1800
Query  1799 TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1850
            TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
Sbjct  1801 TTPVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST 1852

Sequence Alignment: 3. Allergen Name: gal d 6.0101 Sequence ID: P87498

 Score = 669.0 bits 2909,  Expect = 2e-192
 Identities = 672/1831 36%, Positives = 1107/1831 60%, Gaps = 99/1831 5%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRG+I ALVLTLVGSQ ++  P F   + Y YNYE  +++G+ ++ L + G+R+ S++EI
Sbjct  1    MRGLISALVLTLVGSQHLNYQPDFGENKVYTYNYESILFSGIPEKGLARTGIRIRSEVEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SG+     L+++ S +  EYNG+WP   F+RS K+TQ ++  ++   KFEYS+G +GN+ 
Sbjct  61   SGIGPKLCLIRIHSIEAAEYNGIWPTSSFSRSLKLTQALTGQLSIPIKFEYSNGHVGNLM 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            AP+   D  +NI RGILN++++++KK Q+ Y +QEAGIGGIC+  Y IQE++K + + VT
Sbjct  121  APDSVSDDGLNIYRGILNILELSLKKMQHSYSIQEAGIGGICNTTYAIQENKKANLVDVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            ++ DLN+C+EKVQ   G AY  PC     + + ++ T  ++YK+K + +  +IT     +
Sbjct  181  KSKDLNSCEEKVQVVTGSAYTQPCQTCQQRNKNSRATATYNYKIKYTHNEAVITQAEVEE 240
Query  241  VYQISPFNEPTG-VAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQ 299
            V+Q +PF+E TG  A++EARQ+L L+EV+ +    P    Q  GSL+Y+F + L Q+P++
Sbjct  241  VHQFTPFHEITGGNAIVEARQKLALIEVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVH 300
Query  300  LIKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKP 359
            L K K+ E++I E LQ +V    + +  D   + L++++L R AN +N ES+W+Q S +P
Sbjct  301  LFKIKDVERQIEERLQDLVETTYEQLPSDAPAKALKLMHLLRAANEENYESVWKQFSSRP 360
Query  360  RYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADL 419
             YRR+LL  + A+ +  +L+FL++++   +L   +   TV + LH     +  +  A  +
Sbjct  361  AYRRYLLDLLPAAASHRSLRFLRHKMERQELTNWEIAQTVLVALHSSSPTQEVMEEATLI 420
Query  420  MTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKL 479
            +     + + VL++V  L Y+S+ ++ CS   +C  E LQ  H +A EA+ +   +++ L
Sbjct  421  VKKHCPRSSSVLRKVCLLSYASLCHKRCSSPYSC-SECLQVFHVFAGEALGKSNIEEVLL 479
Query  480  ALKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQ 539
            ALK +GN+G PAS+K I KFLP  ++ A+++P+ ++  A+ ALK I  +DP+ VQ   ++
Sbjct  480  ALKALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPQMVQAITLE 539
Query  540  ILADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRL 599
            I+ ++ + P +RM+A  V++ET+P L ++  + +  +KE +MQVASF+YSH+++L +S  
Sbjct  540  IFLNHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKEPSMQVASFIYSHLRALGRSTA 599
Query  600  PFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFP 659
            P +  ++SAC +A++ LSPK+D   Y++SKV R   + +    G   + FV+N+  ++ P
Sbjct  600  PDLQMMASACRMAVRALSPKFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAGSLIP 659
Query  660  SAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKE 719
            +  +S+L  +  G VAD +EVGI  EGL ++ ++   P  ++ T    +E+ K L  WK 
Sbjct  660  TMAVSQLRTHFLGRVADPIEVGIAAEGLQEMFVRGYSPDKDWETNYDFREILKKLSDWKA 719
Query  720  LPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQ 779
            LP + P+ S YLK++GQE+ F  ++K+ LQ V++    P ++  +I+R+ + ++  I  Q
Sbjct  720  LPRDKPFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPSIRRLISSLQTGIGRQ 779
Query  780  WTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTM 839
            WT+ + + E+R +VP+C+G+P+E   Y +++ + A +V+ ++TP    DFRL++LL S +
Sbjct  780  WTKALLLSEIRCIVPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDFRLTELLNSNV 839
Query  840  QIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNP 899
            ++RS +  S+  H    +G+NT   Q  +E + +V   +P+   A I +K K++K E  P
Sbjct  840  RLRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMKEKSIKAEIPP 899
Query  900  CREETEIVVGRHKAFAVSRNIGELGVEKRTSIL-PEDAPLDVTEEPFQTSERASREHFAM 958
            C+EET +++   K FAV+RNI +L   K T +L PE  P D+ +  F  S+ AS E   +
Sbjct  900  CKEETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVP-DIMKMSFD-SDSASGETDNI 957
Query  959  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1018
            +   S+    S +S      S+GK    + +C      G Q+C  ++S  A+FI+N  L+
Sbjct  958  RDRQSVEDVSSGNSFSFGHPSSGKEPFIQSMCSNASTFGVQVCIEKKSVHAAFIRNVPLY 1017
Query  1019 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1078
              IGEH  ++ + PV++D  I+KIQ+ IQAG +A  +++  V  E  E  ESS  +++  
Sbjct  1018 NAIGEHALRMSFKPVYSDVPIEKIQVTIQAGDQAPTKMVRLVTFEDPERQESS-RKEVMK 1076
Query  1079 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSS 1138
            ++K+IL         + T +   R S+  ++  +      ++ TS+ SSS S    S   
Sbjct  1077 RVKKIL---------DDTDNQATRNSRSSSSSASSISESSESTTSTPSSSDSDNRASQGD 1127
Query  1139 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1198
               +  +R+   +E++      + +  +SSSS SS SS+S   SSS+SS+SS  SSSSSS
Sbjct  1128 PQINLKSRQSKANEKKFYPFGDSSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSSSS 1187
Query  1199 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS-S 1257
            SSSSSS  S SSS SS +++SSSSS+   SSSS S+S+SK SSSSSS +S +  K+   S
Sbjct  1188 SSSSSSSKSKSSSRSSKSNRSSSSSNSKDSSSSSSKSNSKGSSSSSSKASGTRQKAKKQS 1247
Query  1258 RSSS-------------------SSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSH---- 1294
            +++S                   + S SSS    S +S   + S+SSSS S  VSH    
Sbjct  1248 KTTSFPHASAAEGERSVHEQKQETQSSSSSSSRASSNSRSTSSSTSSSSESSGVSHRQWK 1307
Query  1295 HSHEHHSGHLEDDSSSSSSSSVLSKIWGRH--EIYQYRFRSAHRQEFPKRKLPGDRATSR 1352
            +  E  +  ++   +S SS  + ++ W  +  ++Y+ RFRSAH +     +     ++S 
Sbjct  1308 QDREAETKRVKSQFNSHSSYDIPNE-WETYLPKVYRLRFRSAHTHWHSGHRTSSSSSSSS 1366
Query  1353 Y-------------SSTRSSH------------------------DTSRAASW---P--- 1369
                          SS+R SH                         TSRAAS    P   
Sbjct  1367 SESGSSHSNSSSSDSSSRRSHMSDSSSSSSSHRHGEKAAHSSRRSPTSRAASAHHRPGSS 1426
Query  1370 -----KFLGDIKTPVLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKW 1424
                  FLGD+  P +    + + ++ +  G Q   Y  +D+ +  VQ+ V  L +++ W
Sbjct  1427 LTRERNFLGDVIPPGITIVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVVVQLAETN-W 1485
Query  1425 KLCADASVRNAHKAVAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSV 1484
            K CADA +    KA A ++WG +CRDY+++    TG+ A   A Q+K++W  +PS ++  
Sbjct  1486 KACADAVILPL-KAQARMRWGKECRDYRIAALATTGQMARKLAVQLKVQWGIIPSWIKKT 1544
Query  1485 VEWFYEFVPGAAFMLGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLP 1544
               +  +VPG A++LGFSE   +NPSR+  +    TSPR+ D V+K+P + LY + +R+P
Sbjct  1545 STALMRYVPGVALVLGFSEAHQRNPSRELIVRAVATSPRSIDTVIKVPGVTLYYQGLRVP 1604
Query  1545 LSLPVGPRIPASELQP-PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPAN 1603
            ++L +G    + E +    WN + E  S + +  ++ C VS    KTF+ + F  S   +
Sbjct  1605 FTLALGASSSSYETRDITAWNFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSFNKS 1664
Query  1604 CYHILVQDCSSELKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPT 1663
            C  ++ QDC+   KF++  +     +  + ++I   S  I + P      L+    ES  
Sbjct  1665 CNVVVAQDCTEHPKFIITTRKVDHQSLSREVHINTSSANITICPAADSSLLVTCNKESVL 1724
Query  1664 ANISLISAGA--SLWIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGK 1721
            ++ S +S     ++ I+   +   + AP HG+  + FDG+ + + V  WM GKTCG+CG 
Sbjct  1725 SD-SGVSEYEKDNIKIYKNGKTVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGVCGN 1783
Query  1722 YDAECEQEYRMPNGYLAKNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKC 1781
             D E   E  MPN  LA +  +F HSW+L E  C G CKL+R +VKL +   + G +S C
Sbjct  1784 NDREKHNELLMPNHKLAHSCSAFVHSWVLLEETCSGGCKLQRRYVKLNRNPTIDGEESTC 1843
Query  1782 YSTEPVLRCAKGCSATKTTPVTVGFHCLPADSANSLTDKQMKYDQKS--EDMQDTVDAHT 1839
            YS +PVL+C K C+  + T V VGFHC+P  +A SL + Q   D+KS  ED+ ++VDA  
Sbjct  1844 YSVDPVLKCMKDCTPIEKTSVKVGFHCFPKATAVSLLEWQRSSDKKSASEDVVESVDADI 1903
Query  1840 TCSCENEECS 1849
             C+C  + CS
Sbjct  1904 DCTCTGD-CS 1912

Sequence Alignment: 4. Allergen Name: Gal Sequence ID: P87498

 Score = 669.0 bits 2909,  Expect = 2e-192
 Identities = 672/1831 36%, Positives = 1107/1831 60%, Gaps = 99/1831 5%
Query  1    MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI 60
            MRG+I ALVLTLVGSQ ++  P F   + Y YNYE  +++G+ ++ L + G+R+ S++EI
Sbjct  1    MRGLISALVLTLVGSQHLNYQPDFGENKVYTYNYESILFSGIPEKGLARTGIRIRSEVEI 60
Query  61   SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY 120
            SG+     L+++ S +  EYNG+WP   F+RS K+TQ ++  ++   KFEYS+G +GN+ 
Sbjct  61   SGIGPKLCLIRIHSIEAAEYNGIWPTSSFSRSLKLTQALTGQLSIPIKFEYSNGHVGNLM 120
Query  121  APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT 180
            AP+   D  +NI RGILN++++++KK Q+ Y +QEAGIGGIC+  Y IQE++K + + VT
Sbjct  121  APDSVSDDGLNIYRGILNILELSLKKMQHSYSIQEAGIGGICNTTYAIQENKKANLVDVT 180
Query  181  RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ 240
            ++ DLN+C+EKVQ   G AY  PC     + + ++ T  ++YK+K + +  +IT     +
Sbjct  181  KSKDLNSCEEKVQVVTGSAYTQPCQTCQQRNKNSRATATYNYKIKYTHNEAVITQAEVEE 240
Query  241  VYQISPFNEPTG-VAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQ 299
            V+Q +PF+E TG  A++EARQ+L L+EV+ +    P    Q  GSL+Y+F + L Q+P++
Sbjct  241  VHQFTPFHEITGGNAIVEARQKLALIEVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVH 300
Query  300  LIKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKP 359
            L K K+ E++I E LQ +V    + +  D   + L++++L R AN +N ES+W+Q S +P
Sbjct  301  LFKIKDVERQIEERLQDLVETTYEQLPSDAPAKALKLMHLLRAANEENYESVWKQFSSRP 360
Query  360  RYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADL 419
             YRR+LL  + A+ +  +L+FL++++   +L   +   TV + LH     +  +  A  +
Sbjct  361  AYRRYLLDLLPAAASHRSLRFLRHKMERQELTNWEIAQTVLVALHSSSPTQEVMEEATLI 420
Query  420  MTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKL 479
            +     + + VL++V  L Y+S+ ++ CS   +C  E LQ  H +A EA+ +   +++ L
Sbjct  421  VKKHCPRSSSVLRKVCLLSYASLCHKRCSSPYSC-SECLQVFHVFAGEALGKSNIEEVLL 479
Query  480  ALKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQ 539
            ALK +GN+G PAS+K I KFLP  ++ A+++P+ ++  A+ ALK I  +DP+ VQ   ++
Sbjct  480  ALKALGNVGHPASIKHIKKFLPGYAAGASELPLKVHETAVMALKSIGMRDPQMVQAITLE 539
Query  540  ILADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRL 599
            I+ ++ + P +RM+A  V++ET+P L ++  + +  +KE +MQVASF+YSH+++L +S  
Sbjct  540  IFLNHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKEPSMQVASFIYSHLRALGRSTA 599
Query  600  PFMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFP 659
            P +  ++SAC +A++ LSPK+D   Y++SKV R   + +    G   + FV+N+  ++ P
Sbjct  600  PDLQMMASACRMAVRALSPKFDRSGYQFSKVFRFSMFKEFLMSGLAAKYFVLNNAGSLIP 659
Query  660  SAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKE 719
            +  +S+L  +  G VAD +EVGI  EGL ++ ++   P  ++ T    +E+ K L  WK 
Sbjct  660  TMAVSQLRTHFLGRVADPIEVGIAAEGLQEMFVRGYSPDKDWETNYDFREILKKLSDWKA 719
Query  720  LPTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQ 779
            LP + P+ S YLK++GQE+ F  ++K+ LQ V++    P ++  +I+R+ + ++  I  Q
Sbjct  720  LPRDKPFASGYLKMFGQELLFGRLDKDTLQNVLQVWYGPDEKIPSIRRLISSLQTGIGRQ 779
Query  780  WTQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTM 839
            WT+ + + E+R +VP+C+G+P+E   Y +++ + A +V+ ++TP    DFRL++LL S +
Sbjct  780  WTKALLLSEIRCIVPTCVGFPMETSFYYSSVTKVAGNVQAQITPSPRSDFRLTELLNSNV 839
Query  840  QIRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNP 899
            ++RS +  S+  H    +G+NT   Q  +E + +V   +P+   A I +K K++K E  P
Sbjct  840  RLRSKMSLSMAKHMTFVIGINTNMIQAGLEAHTKVNAHVPVNVVATIQMKEKSIKAEIPP 899
Query  900  CREETEIVVGRHKAFAVSRNIGELGVEKRTSIL-PEDAPLDVTEEPFQTSERASREHFAM 958
            C+EET +++   K FAV+RNI +L   K T +L PE  P D+ +  F  S+ AS E   +
Sbjct  900  CKEETNLIIVSSKTFAVTRNIEDLAASKMTPVLLPEAVP-DIMKMSFD-SDSASGETDNI 957
Query  959  QGPDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLH 1018
            +   S+    S +S      S+GK    + +C      G Q+C  ++S  A+FI+N  L+
Sbjct  958  RDRQSVEDVSSGNSFSFGHPSSGKEPFIQSMCSNASTFGVQVCIEKKSVHAAFIRNVPLY 1017
Query  1019 KLIGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQA 1078
              IGEH  ++ + PV++D  I+KIQ+ IQAG +A  +++  V  E  E  ESS  +++  
Sbjct  1018 NAIGEHALRMSFKPVYSDVPIEKIQVTIQAGDQAPTKMVRLVTFEDPERQESS-RKEVMK 1076
Query  1079 KLKRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSS 1138
            ++K+IL         + T +   R S+  ++  +      ++ TS+ SSS S    S   
Sbjct  1077 RVKKIL---------DDTDNQATRNSRSSSSSASSISESSESTTSTPSSSDSDNRASQGD 1127
Query  1139 SSASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSS 1198
               +  +R+   +E++      + +  +SSSS SS SS+S   SSS+SS+SS  SSSSSS
Sbjct  1128 PQINLKSRQSKANEKKFYPFGDSSSSGSSSSSSSSSSSSSDSSSSSRSSSSSDSSSSSSS 1187
Query  1199 SSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSS-S 1257
            SSSSSS  S SSS SS +++SSSSS+   SSSS S+S+SK SSSSSS +S +  K+   S
Sbjct  1188 SSSSSSSKSKSSSRSSKSNRSSSSSNSKDSSSSSSKSNSKGSSSSSSKASGTRQKAKKQS 1247
Query  1258 RSSS-------------------SSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSH---- 1294
            +++S                   + S SSS    S +S   + S+SSSS S  VSH    
Sbjct  1248 KTTSFPHASAAEGERSVHEQKQETQSSSSSSSRASSNSRSTSSSTSSSSESSGVSHRQWK 1307
Query  1295 HSHEHHSGHLEDDSSSSSSSSVLSKIWGRH--EIYQYRFRSAHRQEFPKRKLPGDRATSR 1352
            +  E  +  ++   +S SS  + ++ W  +  ++Y+ RFRSAH +     +     ++S 
Sbjct  1308 QDREAETKRVKSQFNSHSSYDIPNE-WETYLPKVYRLRFRSAHTHWHSGHRTSSSSSSSS 1366
Query  1353 Y-------------SSTRSSH------------------------DTSRAASW---P--- 1369
                          SS+R SH                         TSRAAS    P   
Sbjct  1367 SESGSSHSNSSSSDSSSRRSHMSDSSSSSSSHRHGEKAAHSSRRSPTSRAASAHHRPGSS 1426
Query  1370 -----KFLGDIKTPVLAAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKW 1424
                  FLGD+  P +    + + ++ +  G Q   Y  +D+ +  VQ+ V  L +++ W
Sbjct  1427 LTRERNFLGDVIPPGITIVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVVVQLAETN-W 1485
Query  1425 KLCADASVRNAHKAVAYVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSV 1484
            K CADA +    KA A ++WG +CRDY+++    TG+ A   A Q+K++W  +PS ++  
Sbjct  1486 KACADAVILPL-KAQARMRWGKECRDYRIAALATTGQMARKLAVQLKVQWGIIPSWIKKT 1544
Query  1485 VEWFYEFVPGAAFMLGFSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLP 1544
               +  +VPG A++LGFSE   +NPSR+  +    TSPR+ D V+K+P + LY + +R+P
Sbjct  1545 STALMRYVPGVALVLGFSEAHQRNPSRELIVRAVATSPRSIDTVIKVPGVTLYYQGLRVP 1604
Query  1545 LSLPVGPRIPASELQP-PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPAN 1603
            ++L +G    + E +    WN + E  S + +  ++ C VS    KTF+ + F  S   +
Sbjct  1605 FTLALGASSSSYETRDITAWNFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSFNKS 1664
Query  1604 CYHILVQDCSSELKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPT 1663
            C  ++ QDC+   KF++  +     +  + ++I   S  I + P      L+    ES  
Sbjct  1665 CNVVVAQDCTEHPKFIITTRKVDHQSLSREVHINTSSANITICPAADSSLLVTCNKESVL 1724
Query  1664 ANISLISAGA--SLWIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGK 1721
            ++ S +S     ++ I+   +   + AP HG+  + FDG+ + + V  WM GKTCG+CG 
Sbjct  1725 SD-SGVSEYEKDNIKIYKNGKTVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGVCGN 1783
Query  1722 YDAECEQEYRMPNGYLAKNAVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKC 1781
             D E   E  MPN  LA +  +F HSW+L E  C G CKL+R +VKL +   + G +S C
Sbjct  1784 NDREKHNELLMPNHKLAHSCSAFVHSWVLLEETCSGGCKLQRRYVKLNRNPTIDGEESTC 1843
Query  1782 YSTEPVLRCAKGCSATKTTPVTVGFHCLPADSANSLTDKQMKYDQKS--EDMQDTVDAHT 1839
            YS +PVL+C K C+  + T V VGFHC+P  +A SL + Q   D+KS  ED+ ++VDA  
Sbjct  1844 YSVDPVLKCMKDCTPIEKTSVKVGFHCFPKATAVSLLEWQRSSDKKSASEDVVESVDADI 1903
Query  1840 TCSCENEECS 1849
             C+C  + CS
Sbjct  1904 DCTCTGD-CS 1912

Sequence Alignment: 5. Allergen Name: Onc k 5.0101 Sequence ID: D5MU14

 Score = 112.4 bits 464,  Expect = 8e-26
 Identities = 70/191 36%, Positives = 111/191 58%, Gaps = 1/191 0%
Query  1556 SELQPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSE 1615
            ++L P   N+  +      E    +CS+  + + TFN  K+  +MP +CY++L QDC+ E
Sbjct  3    TDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIE 62
Query  1616 LKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASL 1675
            LKF+V++K    A+    IN+KI   ++D++  +  V + V+  E    N+       S+
Sbjct  63   LKFMVLLKK-DHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSI 121
Query  1676 WIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNG 1735
             I  + +G +L A  HG+ ++YFD  +  I+V  WM G+TCG+CGK D E  QEYR P+G
Sbjct  122  MIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSG 181
Query  1736 YLAKNAVSFGHS 1747
             L K++VSF HS
Sbjct  182  RLTKSSVSFAHS 193

Sequence Alignment: 6. Allergen Name: Gal d vitellogenin Sequence ID: CAA25027

 Score = 98.9 bits 383,  Expect = 4e-22
 Identities = 71/71 100%, Positives = 71/71 100%, Gaps = 10/71 14%
Query  1    MRGIILALVLTLV----------GSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKA 50
            MRGIILALVLTLV          GSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKA
Sbjct  1    MRGIILALVLTLVAHVVFLSLFVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKA 60
Query  51   GVRLSSKLEISGLPENAYLLK 71
            GVRLSSKLEISGLPENAYLLK
Sbjct  61   GVRLSSKLEISGLPENAYLLK 81

Sequence Alignment: 7. Allergen Name: Asp f 16 Sequence ID: AAC61261

 Score = 42.0 bits 157,  Expect = 0.0003
 Identities = 40/127 31%, Positives = 73/127 57%, Gaps = 11/127 8%
Query  1180 KRSSSKSSNSSKRSSSSSSSSSSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKS 1239
            +R SS SS +S  +S++SS+SS+SS++ S+S+ ++S   + + S  SS S+S S +   +
Sbjct  268  RRYSSSSSVTSSTTSTASSASSTSSKTPSTSTLATSTKATPTPSGTSSGSNSSSSAEPTT 327
Query  1240 SSSSSSSSSSSSSK-------SSSSRSSSSSSKSSSHHSHSHHSGHLNGSSSS----SSS 1288
            +  S SS++ S  +        SS+ SS+S+  S++       +G + GS +     S+ 
Sbjct  328  TGGSGSSNTGSWLRLRLWLWLYSSTGSSTSAGASATPELSQGAAGSIKGSVTPALWCSAP 387
Query  1289 SRSVSHHSHEHHSGHLED 1306
            S    H  +    G + D
Sbjct  388  SLPCWHSKQNDDFGLMHD 405

Sequence Alignment: 8. Allergen Name: Der p 14.0101 Sequence ID: AAM21322

 Score = 43.5 bits 165,  Expect = 0.0004
 Identities = 144/633 22%, Positives = 314/633 49%, Gaps = 88/633 13%
Query  107  FKFEYSSGRIGNIYAPEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARY 166
            F F Y +GRI  +   +D  D  +N+ + I++ +Q       NV + +E    G C   Y
Sbjct  96   FAFGYFNGRILGVCPADDDQDWSLNVKKAIVSSLQAL--SDGNVEKAEEIDFSGRCPTEY 153
Query  167  VIQEDRKNSRIYVTRTVDLNNCQEK---VQKSIGMAYIYPCPVDVMKERLTKGTTAFSYK 223
                 + ++ + + +  DLN C ++   ++++   A       ++M+  +    + +S +
Sbjct  154  RKIRSQDDNTVVIEKRKDLNLCDDRRIDLRQTPDQALGQL--KELMRHYMHPMDSDLSCR 211
Query  224  LKQSDSGTLITDVSSRQVYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYG 283
            +   D      D   R+V  +   N+P  ++ ++      ++  +++ G A D+   N  
Sbjct  212  MTLKDKVVTEVDCEERHVL-VHRSNKPVHMSYVK------MMLKQNKDGVAADLGPTNAQ 264
Query  284  SLRYRFPAVLPQMPLQLIKTKNP-EQRIVETLQHIVLN-NQQDFHDDVSYRFLEVVQLCR 341
              R       P + +   K KNP E  +VE L+ +     +     + S+ F ++V   R
Sbjct  265  PKR-------PYLSFDH-KHKNPTETDVVEVLKKLCSEITEPQASIETSFTFQKLVDKLR 316
Query  342  IANADNLESIWRQVSDK--P----RYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQT 395
              +A+   S+   V     P    R R  +L A + + +  +++ L     N +L+  ++
Sbjct  317  YLSAEETASVDESVKTSVCPAHAHRLRELFLDASAFAASDGSIRTLVKAHENQELSITRS 376
Query  396  LLTVSLTLHLLQA--DEHTLPIAADLMTSSRIQKNPVLQQVACLGYSSVVNRYCSQTSAC 453
              T  +T+  ++A  ++ T+ +   ++ S +  + P+L     LG+S +V RYC +T+ C
Sbjct  377  --TALFTVAAIKAAPNKETVQVLLPVIASEKTIR-PML-----LGFSVLVRRYCEKTNDC 428
Query  454  PKEA-LQPIHD--LADEAISRGREDKMKL--ALKCIGNMGEPASLKRILKFLPISSSSAA 508
               + ++   D  LA  A++R   ++M +  AL+ + N+        +     I  S+ A
Sbjct  429  ATNSGVKDARDAYLARLAVARDASERMTIVRALENL-NVNTDGVDNMVNAMDEIIKSTDA 487
Query  509  DIPVHIQIDAITALKKIAWKDPKTVQGYLIQILADQSLPPEVRMMACAVIFETRPALALI 568
            + P  ++  A+ AL      D   +  Y   ++ D+S+P E R+ A    F+       +
Sbjct  488  E-PA-MRAAAVNALPN----DASHMDRYKSLVM-DESMPNEARIAA----FQKMMKNGGM 536
Query  569  TTIANV-AMKESNMQVASFVYSHMKSLSKSRLPFMYNISSACNIALKLLSPKLD-SMSYR 626
            + I ++ A+K   M+  ++V +++ +L KS+   +   +   ++ L    PK +  ++  
Sbjct  537  SHIKDLFAVKGECMK--NYVLTYVDNLKKSKND-LRRQTVGEDVELPE-KPKREIGITRN 592
Query  627  YSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPSAIISKLMANSAGSVADLVEVGIRVEG 686
             ++     T+  +     T E    N  R+     I  +L+ +    + +LVE  +   G
Sbjct  593  IAREYGPYTFEYDVIYPETHE----NVTRS-----INGRLIRSKNDQLKELVEFQVTQSG 643
Query  687  LADVIMKRNIPFAEYPTYKQI----KELGKALQGWKELPTETPLVSAYLKILGQEVAFIN 742
            + D  +   + + E  +++ +    +++ K L   ++   +   +   ++I G+ V F +
Sbjct  644  F-DRELNNAMSLLEKKSFQSVMQFLRDMLKMLSQIRKNADDNHHMKITVQINGKNVYFTD 702
Query  743  INKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQWTQPVWMGELRYVVPSCLGLPLE 802
                L+Q   K       +   +KR+   I +    +    V + + + V+P+  GLPL 
Sbjct  703  ----LFQDTKKM------KELLMKRVEKIINDKKVDRSIGGVLL-DSKLVLPTITGLPLM 751
Query  803  Y 803
            Y
Sbjct  752  Y 752

Sequence Alignment: 9. Allergen Name: Eur m 14 Sequence ID: AAF14270

 Score = 39.0 bits 145,  Expect = 0.009
 Identities = 143/624 22%, Positives = 316/624 50%, Gaps = 106/624 16%
Query  107  FKFEYSSGRIGNIYAPEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARY 166
            F F Y +GRI  +    D  D  +N+ + I++ +Q+   ++++  +++E    G C   Y
Sbjct  102  FAFGYFNGRILGVCPANDDQDWSLNVKKAIVSALQVQFDENKD--KVEETDFSGTCPTEY 159
Query  167  ----------VIQEDRKNSRIYVTRTVDLNNCQEKVQ---KSIGMAYIYPCPVDVMKERL 213
                      V+ E RK+  +   R VDL    ++     K I   Y++P   D+M  R+
Sbjct  160  RKIRSDDDNTVVMEKRKDLNLCDDRRVDLRQTPDQALGQLKEIIRHYMHPMDSDLMC-RM 218
Query  214  TKGTTAFSYKLKQSDSGTLITDVSSRQVYQISPFNEPTGVAVMEARQQLTLVEVRSERGS 273
            T         LK  D      D   R+V  +   ++P  ++ ++   + +   V ++ G 
Sbjct  219  T---------LK--DKVVSEVDCEERHVL-VHRSHKPIHLSYVKMMLKQSKDGVAADLGQ 266
Query  274  APDVPMQNYGSLRYRFPAVLPQMPLQLIKTKNP-EQRIVETLQHIVLN-NQQDFHDDVSY 331
                P + Y S+ +              K KNP E  +V+ L+ +     +     + S+
Sbjct  267  TDSEPKRPYLSFDH--------------KHKNPTETDVVQVLKKLCTEITEPQASIETSF 312
Query  332  RFLEVVQLCRIANADNLESIWRQVSDK--P----RYRRWLLSAVSASGTTETLKFLKNRI 385
             F ++V   R  +A+   ++   V     P    R R  +L A + + +  +++ L    
Sbjct  313  TFHKLVDKLRYLSAEETATVDESVKTAICPAHAKRIRELFLDASAFAASDGSIRTLVKAH 372
Query  386  RNDDLNYIQTLLTVSLTLHLLQA--DEHTLPIAADLMTSSRIQKNPVLQQVACLGYSSVV 443
             N +L+  ++  T  +T+  ++A  ++ T+ +   ++ S +  + P+L     LG+S +V
Sbjct  373  ENQELSVTRS--TALFTVAAIKAAPNKETVNVLLPVIASEKTIR-PML-----LGFSVLV 424
Query  444  NRYCSQTSACPKEA-LQPIHD--LADEAISRGREDKMKLALKCIGNMG-EPASLKRILKF 499
             RYC +++ C   + ++   D  LA  A+++   ++M + ++ + N+      +  ++  
Sbjct  425  RRYCEKSADCASNSGVKDARDAYLARLAVAKDPSERMTI-VRALENLNVNTEDVDNMINA 483
Query  500  LP-ISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQILADQSLPPEVRMMACAVI 558
            +  I  S+ A+ P  ++  A+ AL      D   +  Y   ++ D+S+P E R+ A    
Sbjct  484  MDEIIKSTDAE-P-SLRAAAVNALPS----DASHMDRYKSLVM-DESMPNEARIAA---- 532
Query  559  FETRPALALITTIANV-AMKESNMQVASFVYSHMKSLSKSRLPFMYNISSACNIALKLLS 617
            F        +T I ++ A+K   M+  ++V +++ ++ KS    +   + A ++ L    
Sbjct  533  FHKMMQNGGMTHIKDLFAVKGDCMK--NYVLTYVDNMQKSNND-LRRRTVAADVELPE-K 588
Query  618  PKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPSAIISKLMANSAGSVADL 677
            PK + M    +       Y   Y V       +          +I  +L+      + +L
Sbjct  589  PKRE-MGITRNIAREYGPYTFEYDV-------IYPETHENVTRSINGRLIRAKNDKLKEL 640
Query  678  VEVGIRVEGLADVIMKRNIPFAEYPTYKQI----KELGKALQGWKELPTETPLVSAYLKI 733
            V++ I   G+ D  +   + + E  +++ +    ++  K L   ++   +   +   +K+
Sbjct  641  VQIQITQNGF-DRELNNAMSLLEKKSFQSVMQFVRDTLKMLAQIRKNADDNHHMKVSVKV 699
Query  734  LGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQWTQPVWMGELRYVV 793
             G+ V + ++ ++L +++ + +V+ A++    K++      SI G       + + +  +
Sbjct  700  NGKNVYYTDVFQDL-KKLKELLVKRAEKIINEKKVDR----SIGGV------LLDSKLAL 748
Query  794  PSCLGLPLEY 803
            P+  GLPL Y
Sbjct  749  PTITGLPLVY 758

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.