The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK
EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP
PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA
Sequence Info Allergen Name Length Opt Bits Score E Value
O04404 Par j 1 176 1211 257.1 2.1e-70
CAI94601 Par j 1.0103 139 964 206.2 3.3e-55
P43217 Par j 1 139 960 205.4 5.8e-55
CAA54587 Par j 1.0101 133 921 197.4 1.4e-52
Q40905 Par j 1 138 820 176.6 2.7e-46
P55958 Par j 2 133 451 100.7 1.8e-23
O04403 Par j 2 133 448 100.1 2.8e-23
NP_001316123 Sola l 7.0101 115 245 58.3 9e-11
P82007 Hel a 3.0101 116 240 57.3 1.9e-10
O04004 Amb a 6 118 234 56.1 4.5e-10
A0A059STC4 Pun g 1.0101 120 234 56.1 4.5e-10
P93224 Sola l 3.0101 114 233 55.9 5e-10
AAB42069 Lyc e 3 114 233 55.9 5e-10
P19656-1 Zea m 14.0101 120 233 55.9 5.2e-10
P19656-2 Zea m 14.0102 128 233 55.9 5.6e-10
A0A059SSZ0 Pun g 1.0201 120 229 55.0 9.2e-10
AAL25839 Hev b 12 116 213 51.8 8.7e-09
W0U0V5 Can s 3.0101 91 211 51.3 9.2e-09
CAL07989 Pla a 3.0101 118 210 51.1 1.4e-08
CAH69206 Tri tu 14.0101 115 206 50.3 2.4e-08
ABY21307 Pla or 3.0101 118 206 50.3 2.4e-08
QIN55516 Art ca 3.0102 117 205 50.1 2.8e-08
P85894 Mor n 3.0101 91 201 49.3 3.8e-08
ACV04796 Api g 2 118 202 49.5 4.3e-08
ABX56711 Ara h 9.0101 116 198 48.7 7.4e-08
19846220 Tri a 14.0101 90 195 48.0 8.9e-08
ACN11576 Pru du 3.0101 123 196 48.3 1e-07
ABX75045 Ara h 9.0201 92 192 47.4 1.4e-07
ACE07187 Art v 3.0202 116 193 47.6 1.5e-07
ANC85020 Art ar 3.0102 116 193 47.6 1.5e-07
ANC85027 Art si 3.0102 116 193 47.6 1.5e-07
Q0Z8V0 Rub i 3.0101 117 192 47.4 1.8e-07
A0AT29 Len c 3.0101 118 192 47.4 1.8e-07
Q8VX12 Fra a 3.0101 117 190 47.0 2.3e-07
A0A059ST23 Pun g 1.0301 120 190 47.0 2.4e-07
EU564847 Art v 3.0301 117 189 46.8 2.7e-07
P81402 Pru p 3 91 187 46.4 2.8e-07
ANC85025 Art la 3.0102 115 188 46.6 3.1e-07
ANC85023 Art gm 3.0102 117 187 46.4 3.6e-07
A0A161AT60 Pis s 3.0101 120 187 46.4 3.7e-07
AAA32970 Hor v 1 117 185 46.0 4.8e-07
ANC85021 Art ca 3.0101 117 185 46.0 4.8e-07
ANC85017 Art an 3.0101 117 185 46.0 4.8e-07
CAB96876 Pru p 3 91 183 45.6 5e-07
CAA42832 Hor v 1 134 184 45.8 6.3e-07
ANC85022 Art gm 3.0101 117 182 45.4 7.3e-07
ADC80503 Pha v 3.0201 118 182 45.4 7.4e-07
ANC85026 Art si 3.0101 116 181 45.2 8.4e-07
Q9M5X8 Pru av 3 117 181 45.2 8.4e-07
ABU95411 Sin a 3.0101 92 179 44.8 8.9e-07
Q9M5X7 Mal d 3 115 180 45.0 9.6e-07
ANC85018 Art an 3.0102 117 180 45.0 9.7e-07
Q4PLT9 Fra a 3.0102 117 180 45.0 9.7e-07
P81651 Pru ar 3 91 176 44.1 1.4e-06
Q4PLT6 Fra a 3.0202 117 176 44.1 1.7e-06
EU564845 Art v 3.0201 114 174 43.7 2.2e-06
ANC85024 Art la 3.0101 116 174 43.7 2.3e-06
ANC85019 Art ar 3.0101 116 174 43.7 2.3e-06
Q4PLU0 Fra a 3.0201 117 173 43.5 2.6e-06
ADC80502 Pha v 3.0101 115 172 43.3 3e-06
P82534 Pru d 3 91 170 42.9 3.2e-06
Q9M5X6 Pyr c 3 115 169 42.7 4.6e-06
A0A510A9S3 Ara h 17.0101 93 163 41.5 8.8e-06
AAK28533 Cor a 8 115 164 41.7 9.4e-06
XP_019446786 Lup an 3.0101 116 154 39.6 3.9e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 257.1 bits 1211,  Expect = 2e-70
 Identities = 176/176 100%, Positives = 176/176 100%, Gaps = 0/176 0%
Query  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
            MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK
Sbjct  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
Query  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
            EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP
Sbjct  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
Query  121  PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA 176
            PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA
Sbjct  121  PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA 176

Sequence Alignment: 2. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 206.2 bits 964,  Expect = 3e-55
 Identities = 136/139 97%, Positives = 138/139 99%, Gaps = 0/139 0%
Query  38   EETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTY 97
            +ETCGT+VRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTY
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  98   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH 157
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH 120
Query  158  KARLERPQIRVPPPAPEKA 176
            KARLERPQIRVPPPAPEKA
Sbjct  121  KARLERPQIRVPPPAPEKA 139

Sequence Alignment: 3. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 205.4 bits 960,  Expect = 6e-55
 Identities = 135/139 97%, Positives = 138/139 99%, Gaps = 0/139 0%
Query  38   EETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTY 97
            +ETCGT+VRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTY
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  98   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH 157
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKT+GVVPRQPQLPVSLRHGPVTGPSDPAH
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAH 120
Query  158  KARLERPQIRVPPPAPEKA 176
            KARLERPQIRVPPPAPEKA
Sbjct  121  KARLERPQIRVPPPAPEKA 139

Sequence Alignment: 4. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 197.4 bits 921,  Expect = 1e-52
 Identities = 130/133 97%, Positives = 132/133 99%, Gaps = 0/133 0%
Query  44   VVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGK 103
            +VRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTYSDIDGK
Sbjct  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
Query  104  LVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 163
            LVSEVPKHCGIVDSKLPPIDVNMDCKT+GVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
Sbjct  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
Query  164  PQIRVPPPAPEKA 176
            PQIRVPPPAPEKA
Sbjct  121  PQIRVPPPAPEKA 133

Sequence Alignment: 5. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 176.6 bits 820,  Expect = 3e-46
 Identities = 125/133 93%, Positives = 127/133 95%, Gaps = 1/133 0%
Query  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
            MRTVSA S+VALVVIVAA L WTS ASVAP APAPGSEETCGTVV ALMPCLPFVQGKEK
Sbjct  1    MRTVSARSSVALVVIVAAVLVWTSSASVAP-APAPGSEETCGTVVGALMPCLPFVQGKEK 59
Query  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
            EPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP
Sbjct  60   EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 119
Query  121  PIDVNMDCKTLGVV 134
            PIDVNMDCKTLGV+
Sbjct  120  PIDVNMDCKTLGVL 133

Sequence Alignment: 6. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 100.7 bits 451,  Expect = 2e-23
 Identities = 73/124 58%, Positives = 89/124 71%, Gaps = 7/124 5%
Query  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
            MRTVS    +A +V++AA LAWTS A  AP APAPG EE CG VV+ +MPCL FV+G+EK
Sbjct  1    MRTVS----MAALVVIAAALAWTSSAEPAP-APAPG-EEACGKVVQDIMPCLHFVKGEEK 54
Query  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
            EPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK C I  + LP
Sbjct  55   EPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDI-KTTLP 113
Query  121  PIDVNMDCKTL 131
            PI  + DC  +
Sbjct  114  PITADFDCSKI 124

Sequence Alignment: 7. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 100.1 bits 448,  Expect = 3e-23
 Identities = 72/124 58%, Positives = 88/124 70%, Gaps = 7/124 5%
Query  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
            MRTVS    +A +V++AA LAWTS A +A  APAPG E  CG VV  +MPCL FV+G+EK
Sbjct  1    MRTVS----MAALVVIAAALAWTSSAELAS-APAPG-EGPCGKVVHHIMPCLKFVKGEEK 54
Query  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
            EPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK CGI  + LP
Sbjct  55   EPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGIT-TTLP 113
Query  121  PIDVNMDCKTL 131
            PI  + DC  +
Sbjct  114  PITADFDCSKI 124

Sequence Alignment: 8. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 58.3 bits 245,  Expect = 9e-11
 Identities = 46/111 41%, Positives = 64/111 57%, Gaps = 13/111 11%
Query  9    AVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFV-QGKEKEPSKGCC 67
            A+A++V+V   LA   LA VA  A       TCG V   L PC+PF+ QG E  P   CC
Sbjct  3    AIAILVLVV--LAVFQLAMVARGAI------TCGQVDANLAPCVPFLTQGGE--PGAACC 52
Query  68   SGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPPIDVNMD 127
            SG + L+G T++   R  AC C++ A   Y ++       +P  CGI  S   PI   ++
Sbjct  53   SGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGI--SLTVPISRTVN 110
Query  128  CKTL 131
            C T+
Sbjct  111  CDTI 114

Sequence Alignment: 9. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 57.3 bits 240,  Expect = 2e-10
 Identities = 40/109 36%, Positives = 60/109 55%, Gaps = 4/109 3%
Query  19   GLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETK 78
            G+A  ++  +A     P    TC  V   L PCLP+++   K P+  CC+GAK+L G T+
Sbjct  7    GVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGATR 65
Query  79   TGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTL 131
            T   R  AC+C +TA      +   + S +P  CGI  S   PI+ N++C T+
Sbjct  66   TQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTS--IPINPNVNCNTI 115

Sequence Alignment: 10. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 56.1 bits 234,  Expect = 4e-10
 Identities = 45/109 41%, Positives = 58/109 53%, Gaps = 9/109 8%
Query  16   VAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDG 75
            VA GL    L S  P   A  +  TC TV   L PC  F+ G+E  PSK CC+G   L+ 
Sbjct  10   VAVGLL---LVSWRPTMFA--ASPTCDTVQNILAPCAGFLTGQE--PSKACCTGVNNLNN 62
Query  76   ETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGV 133
              KT   RV  C CI+   K+ +  D K +  +   CG V   +P +D N+DC  L V
Sbjct  63   SRKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKCG-VKPDFPAVDKNLDCSKLPV 118

Sequence Alignment: 11. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 56.1 bits 234,  Expect = 5e-10
 Identities = 37/101 36%, Positives = 57/101 56%, Gaps = 5/101 4%
Query  24   SLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQR 83
            ++A VA P  A  +  TCG V  +L PC+P+ +         CCSG K LDG  +T   R
Sbjct  15   AVALVAAPI-ATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDR 73
Query  84   VHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDC 128
               C+C+++A  + S I+  LV+ +P  CG+ +  K+ P   + DC
Sbjct  74   QATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISP---STDC 116

Sequence Alignment: 12. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 55.9 bits 233,  Expect = 5e-10
 Identities = 37/93 39%, Positives = 54/93 58%, Gaps = 7/93 7%
Query  34   APGSEE-TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQT 92
            AP +E  +CG V   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  93   AMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 131
            A  +   ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 13. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 55.9 bits 233,  Expect = 5e-10
 Identities = 37/93 39%, Positives = 54/93 58%, Gaps = 7/93 7%
Query  34   APGSEE-TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQT 92
            AP +E  +CG V   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  93   AMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 131
            A  +   ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 14. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 55.9 bits 233,  Expect = 5e-10
 Identities = 40/107 37%, Positives = 63/107 58%, Gaps = 19/107 17%
Query  4    VSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPS 63
            V A + VALV++ AA    TS A++           +CG V  A+ PC+ + +G+   PS
Sbjct  9    VVATAVVALVLLAAA----TSEAAI-----------SCGQVASAIAPCISYARGQGSGPS 53
Query  64   KGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PI 122
             GCCSG + L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I
Sbjct  54   AGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTI 110
Query  123  DVNMDC 128
              + DC
Sbjct  111  STSTDC 116

Sequence Alignment: 15. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 55.9 bits 233,  Expect = 6e-10
 Identities = 40/107 37%, Positives = 63/107 58%, Gaps = 19/107 17%
Query  4    VSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPS 63
            V A + VALV++ AA    TS A++           +CG V  A+ PC+ + +G+   PS
Sbjct  9    VVATAVVALVLLAAA----TSEAAI-----------SCGQVASAIAPCISYARGQGSGPS 53
Query  64   KGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PI 122
             GCCSG + L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I
Sbjct  54   AGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTI 110
Query  123  DVNMDC 128
              + DC
Sbjct  111  STSTDC 116

Sequence Alignment: 16. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 55.0 bits 229,  Expect = 9e-10
 Identities = 32/89 35%, Positives = 49/89 55%, Gaps = 4/89 4%
Query  37   SEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKT 96
            S  TCG V  +L PC+P+ +G    PS  CCSG + L+   KT   R  AC C++   ++
Sbjct  27   SAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARS 86
Query  97   YSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDC 128
             + I+   V  +P  CG+ +  K+ P   + DC
Sbjct  87   ITGINYGRVGALPGKCGVSIPYKISP---STDC 116

Sequence Alignment: 17. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 51.8 bits 213,  Expect = 9e-09
 Identities = 30/97 30%, Positives = 53/97 54%, Gaps = 4/97 4%
Query  32   APAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQ 91
            AP      TCG V  AL+PCL +++     P   CC+G + ++   KT   R  AC+C++
Sbjct  18   APMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLK 77
Query  92   TAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            +A  +   ++   V+ +P  CG+    +P  I ++ +C T+
Sbjct  78   SAAGSVKGLNPTTVAGLPGKCGV---NIPYKISLSTNCATV 115

Sequence Alignment: 18. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 51.3 bits 211,  Expect = 9e-09
 Identities = 31/88 35%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  100  IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 131
            ++  L S +P  CG+ +  K+ P   + DC ++
Sbjct  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90

Sequence Alignment: 19. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 51.1 bits 210,  Expect = 1e-08
 Identities = 42/106 39%, Positives = 57/106 53%, Gaps = 7/106 6%
Query  18   AGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGE 76
            A LA   LA +   AP   +  TCGTVV  L PCL F++ G    P+  CC+G K L+ +
Sbjct  7    AKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPA--CCNGVKALNND 64
Query  77   TKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
             KT   R  AC C++TA  + S I     + +   CG+    LP  I   +DC
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGV---NLPYKISPTIDC 114

Sequence Alignment: 20. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 50.3 bits 206,  Expect = 2e-08
 Identities = 40/110 36%, Positives = 62/110 56%, Gaps = 18/110 16%
Query  5    SAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSK 64
            SA + V LV +VAA L   + A+V           +CG V  AL PC+ + +G    PS 
Sbjct  4    SAVAQVVLVAVVAAMLLAVTEAAV-----------SCGQVSSALSPCISYARGNGASPSA 52
Query  65   GCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PID 123
             CCSG + L    ++   +  AC+CI++A    +   GK    +P  CG+    +P  I 
Sbjct  53   ACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--GKAAG-IPTKCGV---SVPYAIS 106
Query  124  VNMDCKTL 131
             ++DC  +
Sbjct  107  SSVDCSKI 114

Sequence Alignment: 21. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 50.3 bits 206,  Expect = 2e-08
 Identities = 41/106 38%, Positives = 57/106 53%, Gaps = 7/106 6%
Query  18   AGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGE 76
            A LA   LA +   AP   +  TCGTVV  L PCL +++ G    P+  CC+G K L+ +
Sbjct  7    AKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNND 64
Query  77   TKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
             KT   R  AC C++TA  + S I     + +   CG+    LP  I   +DC
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGV---NLPYKISPTIDC 114

Sequence Alignment: 22. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 50.1 bits 205,  Expect = 3e-08
 Identities = 31/88 35%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL F++   + P+  CC+G K L+   KTG  R  AC C++T  K+  D
Sbjct  28   TCSDVSNKITPCLSFLKQGGEVPAD-CCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKD 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            +       +P  CG+    +P  I +  DC T+
Sbjct  87   LKSDNAVVLPSKCGV---NIPYKISLETDCNTV 116

Sequence Alignment: 23. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 49.3 bits 201,  Expect = 4e-08
 Identities = 29/88 32%, Positives = 51/88 57%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  +L PC+ +++     P+  CC+G + L+   KT   R  AC C+++A  +   
Sbjct  2    TCGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  100  IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 131
            ++  L + +P  CG+ V  K+ P   + DCK++
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISP---STDCKSV 90

Sequence Alignment: 24. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 49.5 bits 202,  Expect = 4e-08
 Identities = 36/95 37%, Positives = 50/95 52%, Gaps = 7/95 7%
Query  28   VAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHAC 87
            +  PA   G   TCG V   L  CL +++G    PS  CC G K L+   KT   R +AC
Sbjct  19   INHPAVVEGL--TCGQVTGKLGGCLGYLKGG-GYPSPACCGGVKGLNSLAKTPADRKQAC 75
Query  88   ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
             C++T   +   I+    S +P  CGI   ++P PI  + DC
Sbjct  76   ACLKTLAGSVKGINYGAASALPGKCGI---RIPYPISPSTDC 114

Sequence Alignment: 25. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 48.7 bits 198,  Expect = 7e-08
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            +CG V  AL PC+PF+  K   P   CCSG + L G  +T   R  AC C++ A  +   
Sbjct  26   SCGQVNSALAPCIPFLT-KGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  85   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 114

Sequence Alignment: 26. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 48.0 bits 195,  Expect = 9e-08
 Identities = 29/84 34%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  41   CGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI 100
            CG V   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
Query  101  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +      +P  CG+    LP  I +N+DC
Sbjct  62   NEDNARSIPPKCGV---NLPYTISLNIDC 87

Sequence Alignment: 27. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 48.3 bits 196,  Expect = 1e-07
 Identities = 38/116 32%, Positives = 63/116 54%, Gaps = 15/116 12%
Query  5    SAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFV-QGKEKEPS 63
            S+   + LV +VA       +  +A   P   +  +CG VV  L PC+ +V  G    PS
Sbjct  3    SSGQLLKLVCLVAV------MCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPS 56
Query  64   KGCCSGAKRLDGETKTGLQRVHACECIQTAMK--TYSDIDGKLVSEVPKHCGI-VDSKLP 120
              CC+G + L    +T   R   C C++ A+    Y++ +  L + +P  CG+ +  K+ 
Sbjct  57   --CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKIS 114
Query  121  PIDVNMDCKTL 131
            P   + DCKT+
Sbjct  115  P---STDCKTI 122

Sequence Alignment: 28. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 47.4 bits 192,  Expect = 1e-07
 Identities = 31/88 35%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            +CG V  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90

Sequence Alignment: 29. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 47.6 bits 193,  Expect = 2e-07
 Identities = 28/85 32%, Positives = 47/85 55%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL +++   + P+  CC+G K L+   KT   R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +   + + +P  CG+    +P  I +  DC
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 30. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 47.6 bits 193,  Expect = 2e-07
 Identities = 28/85 32%, Positives = 47/85 55%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL +++   + P+  CC+G K L+   KT   R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +   + + +P  CG+    +P  I +  DC
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 31. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 47.6 bits 193,  Expect = 2e-07
 Identities = 28/85 32%, Positives = 47/85 55%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL +++   + P+  CC+G K L+   KT   R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +   + + +P  CG+    +P  I +  DC
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 32. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 47.4 bits 192,  Expect = 2e-07
 Identities = 30/107 28%, Positives = 55/107 51%, Gaps = 6/107 5%
Query  20   LAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKT 79
            LA  +L  +    P      TCG V + + PC+ +V+     P+  CC+G + L+ + KT
Sbjct  9    LALVALLCIVVAVPV-AQAITCGQVTQNVAPCFNYVKNGGAVPA-ACCNGVRNLNSQAKT 66
Query  80   GLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
               R + C C++ A  +   ++  L + +P  CG+    +P  I  + +C T+
Sbjct  67   TADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGV---SVPYKISTSTNCATV 116

Sequence Alignment: 33. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 47.4 bits 192,  Expect = 2e-07
 Identities = 30/96 31%, Positives = 47/96 48%, Gaps = 5/96 5%
Query  32   APAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQ 91
            AP      +CG V   L PCL ++ G    PS  CC G K+L     T   R  AC C++
Sbjct  20   APMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLK 78
Query  92   TAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            +A  + + ++    + +P  CG+    +P  I    +C T+
Sbjct  79   SAAGSITKLNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116

Sequence Alignment: 34. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 47.0 bits 190,  Expect = 2e-07
 Identities = 29/85 34%, Positives = 44/85 51%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V   + PCL +V+     P+  CCSG + L+G  KT   R  AC C++ A      
Sbjct  28   TCGQVASNISPCLTYVKSGGAVPA-ACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            ++  L + +P  CG+    +P  I    +C
Sbjct  87   LNPNLAAGLPGKCGV---SVPYKISTTTNC 113

Sequence Alignment: 35. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 47.0 bits 190,  Expect = 2e-07
 Identities = 35/106 33%, Positives = 54/106 50%, Gaps = 6/106 5%
Query  18   AGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEP-SKGCCSGAKRLDGE 76
            AG+    +A VA      G   TCG V  +L  C+ + +G    P  + CC+G + L+  
Sbjct  10   AGFVLVCMA-VASTVAEAGI--TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSA 66
Query  77   TKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMD 127
             KT   R  AC C+++   + S I+  LV+  P  CG+ +  K+ P   N D
Sbjct  67   AKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAP-STNCD 117

Sequence Alignment: 36. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 46.8 bits 189,  Expect = 3e-07
 Identities = 30/88 34%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  37   SEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKT 96
            S  TC  V   + PCL +++ K  E    CC+G K L+  TKT   R  AC C++ + K+
Sbjct  25   SALTCSDVSTKISPCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKS 83
Query  97   YSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
              D+   +   +P  CG+    LP  + +  DC
Sbjct  84   NKDLKSDFAVPLPSKCGL---NLPYKLSLETDC 113

Sequence Alignment: 37. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 46.4 bits 187,  Expect = 3e-07
 Identities = 27/88 30%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  AL PC+P+V+G    P   CC+G + ++   +T   R  AC C++    +   
Sbjct  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90

Sequence Alignment: 38. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 46.6 bits 188,  Expect = 3e-07
 Identities = 29/85 34%, Positives = 45/85 52%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL +++ K  E    CC+G K L+  TKT   R  AC C++ + K+  D
Sbjct  26   TCSDVSTKISPCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 84
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +   +   +P  CG+    LP  + +  DC
Sbjct  85   LKSDFAVPLPSKCGL---NLPYKLSLETDC 111

Sequence Alignment: 39. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 46.4 bits 187,  Expect = 4e-07
 Identities = 29/85 34%, Positives = 45/85 52%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL F++   + P+  CC+G K L+   KT   R  AC C++T+ K+  D
Sbjct  28   TCSDVSNKISPCLSFLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +       +P  CG+    +P  I +  DC
Sbjct  87   LKSDNAVVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 40. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 46.4 bits 187,  Expect = 4e-07
 Identities = 31/101 30%, Positives = 52/101 51%, Gaps = 8/101 7%
Query  25   LASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKE-PSKGCCSGAKRLDGETKTGLQR 83
            +  +AP A A  S   CGTV   + PC+ ++Q      P   CC+G K+L     T   R
Sbjct  16   MVVIAPMAEAALS---CGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDR 72
Query  84   VHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
              AC C+++A  +   ++    + +P  CG+    +P  I  + +C T+
Sbjct  73   QAACNCLKSAAGSIPKLNTNNAAALPGKCGV---SIPYKISTSTNCNTV 118

Sequence Alignment: 41. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 46.0 bits 185,  Expect = 5e-07
 Identities = 33/114 28%, Positives = 56/114 49%, Gaps = 10/114 8%
Query  9    AVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCS 68
            A A V+++AA L     A     AP       CG V   + PCL +VQG    PS  CC+
Sbjct  2    ARAQVLLMAAALVLMLTA-----APRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCN 55
Query  69   GAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMD 127
            G + L  + ++   R   C C++   +   +++    + +P  C + V   + P   ++D
Sbjct  56   GVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISP---DID 112
Query  128  CKTL 131
            C  +
Sbjct  113  CSRI 116

Sequence Alignment: 42. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 46.0 bits 185,  Expect = 5e-07
 Identities = 31/84 36%, Positives = 43/84 51%, Gaps = 7/84 8%
Query  40   TCGTVVRALMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYS 98
            TC  V   ++PC  F+ QG E   S  CC+G K L+   KT   R  AC C++T  K+  
Sbjct  28   TCSDVSNKILPCTSFLKQGGE--VSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNK 85
Query  99   DIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            D        +P  CG+    +P  I +  DC
Sbjct  86   DFKSDNAVVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 43. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 46.0 bits 185,  Expect = 5e-07
 Identities = 31/84 36%, Positives = 43/84 51%, Gaps = 7/84 8%
Query  40   TCGTVVRALMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYS 98
            TC  V   ++PC  F+ QG E   S  CC+G K L+   KT   R  AC C++T  K+  
Sbjct  28   TCSDVSNKILPCTSFLKQGGE--VSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNK 85
Query  99   DIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            D        +P  CG+    +P  I +  DC
Sbjct  86   DFKSDNAVVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 44. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 45.6 bits 183,  Expect = 5e-07
 Identities = 26/88 29%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  +L PC+P+V+G    P   CC+G + ++   +T   R  AC C++    +   
Sbjct  2    TCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---SIPYKISASTNCATV 90

Sequence Alignment: 45. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 45.8 bits 184,  Expect = 6e-07
 Identities = 33/111 29%, Positives = 55/111 49%, Gaps = 10/111 9%
Query  9    AVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCS 68
            A A V+++AA L     A     AP       CG V   + PCL +VQG    PS  CC+
Sbjct  2    ARAQVLLMAAALVLMLTA-----APRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCN 55
Query  69   GAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMD 127
            G + L  + ++   R   C C++   +   +++    + +P  C +    +P  I  ++D
Sbjct  56   GVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNV---NVPYTISPDID 112
Query  128  C 128
            C
Sbjct  113  C 113

Sequence Alignment: 46. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 45.4 bits 182,  Expect = 7e-07
 Identities = 28/85 32%, Positives = 44/85 51%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PC  F++   + P+  CC+G K L+   KT   R  AC C++T+ K+  D
Sbjct  28   TCSDVSNKISPCTSFLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
                  + +P  CG+    +P  I +  DC
Sbjct  87   FKSDNAAVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 47. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 45.4 bits 182,  Expect = 7e-07
 Identities = 30/103 29%, Positives = 48/103 46%, Gaps = 5/103 4%
Query  25   LASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRV 84
            L  V   AP   +  +CG V  +L  C+PF+      P+  CCSG + L+   KT   R 
Sbjct  13   LCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPAS-CCSGVRSLNAAAKTTPDRQ 71
Query  85   HACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
              C C+++A       +      +P  CG+    +P  I  + +C T+
Sbjct  72   AVCNCLKSAAGAIPGFNANNAGILPGKCGV---SIPYKISTSTNCATI 116

Sequence Alignment: 48. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 45.2 bits 181,  Expect = 8e-07
 Identities = 27/85 31%, Positives = 44/85 51%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   + PCL +++   + P+  CC+G K L+   KT   R  AC C++ + KT  D
Sbjct  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            +       +P  CG+    +P  + +  DC
Sbjct  86   LKSDYAVPLPSKCGVT---IPYKLSMETDC 112

Sequence Alignment: 49. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 45.2 bits 181,  Expect = 8e-07
 Identities = 39/112 34%, Positives = 61/112 54%, Gaps = 16/112 14%
Query  5    SAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSK 64
            SA + +ALVV      A   + SV P A A     TCG V   L PC+ +V+G    P  
Sbjct  4    SAMTKLALVV------ALCMVVSV-PIAQA----LTCGQVSSNLAPCIAYVRGGGAVPP- 51
Query  65   GCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPID 123
             CC+G + ++   KT   R  AC C++    +   ++    + +P  CG+ V  K+ P  
Sbjct  52   ACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISP-- 109
Query  124  VNMDCKTL 131
             + +C T+
Sbjct  110  -STNCATV 116

Sequence Alignment: 50. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 44.8 bits 179,  Expect = 9e-07
 Identities = 26/88 29%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            +CGTV   L  C+ ++      P KGCC+G   L+   +T   R +AC C+  A  ++  
Sbjct  3    SCGTVNSNLAACIGYLTQNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +PK CG+    +P  I  + +C ++
Sbjct  62   LNAARAAALPKACGV---NIPYKISKSTNCNSV 91

Sequence Alignment: 51. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 45.0 bits 180,  Expect = 1e-06
 Identities = 26/88 29%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  +L PC+ +V+     P   CC+G + ++G  +T   R  AC C++    + S 
Sbjct  26   TCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISG 84
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  85   VNPNNAAGLPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 52. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 45.0 bits 180,  Expect = 1e-06
 Identities = 28/85 32%, Positives = 46/85 54%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V + + PC  F++ K  E    CC+G K L+   KT   R  AC C++T+ K+ ++
Sbjct  28   TCNDVTKKISPCTSFLE-KGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNN 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
               +  + +P  CG+    +P  I +  DC
Sbjct  87   FKEENAAVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 53. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 45.0 bits 180,  Expect = 1e-06
 Identities = 27/85 31%, Positives = 43/85 50%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V   + PC+ +V+     P+  CCSG + L+G  KT   R   C C++ A      
Sbjct  28   TCGQVASNISPCVTYVKSGGAVPAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            ++  L + +P  CG+    +P  I    +C
Sbjct  87   LNPNLAAGLPGKCGV---SVPYKISTTTNC 113

Sequence Alignment: 54. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 44.1 bits 176,  Expect = 1e-06
 Identities = 26/88 29%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  +L PC+ +V+G    P   CC+G + ++   +T   R  AC C++    + S 
Sbjct  2    TCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---NIPYKISASTNCATV 90

Sequence Alignment: 55. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 44.1 bits 176,  Expect = 2e-06
 Identities = 29/112 25%, Positives = 53/112 47%, Gaps = 6/112 5%
Query  12   LVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAK 71
            + +  A  L+  +L  +    P      TCG V  ++ PC+ +V+     P+  CC+G +
Sbjct  1    MAISTAMKLSLVALLCIVVALPI-AQAITCGQVASSISPCVNYVKSGGAVPA-ACCNGIR 58
Query  72   RLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
             L+   KT   R   C C++ A      ++  L + +P  CG+    +P  I  + +C
Sbjct  59   SLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGV---NVPYKISTSTNC 113

Sequence Alignment: 56. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 43.7 bits 174,  Expect = 2e-06
 Identities = 26/84 30%, Positives = 43/84 51%, Gaps = 5/84 5%
Query  41   CGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI 100
            C  V   +  CL +++   + P+  CC+G K L+   KT   R  AC C++T  K+  D 
Sbjct  26   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 84
Query  101  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
               + + +P  CG+    +P  I +  DC
Sbjct  85   KSDFAASLPSKCGV---NIPYKISLETDC 110

Sequence Alignment: 57. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 43.7 bits 174,  Expect = 2e-06
 Identities = 26/84 30%, Positives = 43/84 51%, Gaps = 5/84 5%
Query  41   CGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI 100
            C  V   +  CL +++   + P+  CC+G K L+   KT   R  AC C++T  K+  D 
Sbjct  28   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  101  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
               + + +P  CG+    +P  I +  DC
Sbjct  87   KSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 58. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 43.7 bits 174,  Expect = 2e-06
 Identities = 26/84 30%, Positives = 43/84 51%, Gaps = 5/84 5%
Query  41   CGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI 100
            C  V   +  CL +++   + P+  CC+G K L+   KT   R  AC C++T  K+  D 
Sbjct  28   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  101  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
               + + +P  CG+    +P  I +  DC
Sbjct  87   KSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 59. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 43.5 bits 173,  Expect = 3e-06
 Identities = 25/85 29%, Positives = 44/85 51%, Gaps = 5/85 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V  ++ PC+ +V+     P+  CC+G + L+   KT   R   C C++ A      
Sbjct  28   TCGQVASSISPCVNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG 86
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128
            ++  L + +P  CG+    +P  I  + +C
Sbjct  87   LNPSLAAGLPGKCGV---SVPYKISTSTNC 113

Sequence Alignment: 60. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 43.3 bits 172,  Expect = 3e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++      +P  CG+    +P  I  + +C ++
Sbjct  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114

Sequence Alignment: 61. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 42.9 bits 170,  Expect = 3e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TCG V   L PC+ +V+G    P   CC+G + ++   +T   R  AC C++    +   
Sbjct  2    TCGQVSSNLAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---NVPYKISASTNCATV 90

Sequence Alignment: 62. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 42.7 bits 169,  Expect = 5e-06
 Identities = 27/88 30%, Positives = 44/88 50%, Gaps = 5/88 5%
Query  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
            TC  V   L PC+ +V+     P   CC+G K ++G  KT   R  AC C++    + S 
Sbjct  26   TCSQVSANLAPCINYVRSGGAVPP-ACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG 84
Query  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            ++      +P  CG+    +P  I  + +C T+
Sbjct  85   VNPGNAESLPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 63. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 41.5 bits 163,  Expect = 9e-06
 Identities = 25/85 29%, Positives = 49/85 57%, Gaps = 10/85 11%
Query  41   CGTVVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTY- 97
            C  V +++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  98   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92

Sequence Alignment: 64. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 41.7 bits 164,  Expect = 9e-06
 Identities = 25/88 28%, Positives = 46/88 52%, Gaps = 4/88 4%
Query  32   APAPGSEETCGTVVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGLQRVHACECI 90
            AP   +  TC  +   L PC+ +++ G    PS  CC G + ++  ++T   R  AC C+
Sbjct  18   APVARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCL 75
Query  91   QTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPP 121
            +   K  + ++  L + +P  CG+ +  K+ P
Sbjct  76   KDTAKGIAGLNPNLAAGLPGKCGVNIPYKISP 107

Sequence Alignment: 65. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 39.6 bits 154,  Expect = 4e-05
 Identities = 27/94 28%, Positives = 46/94 48%, Gaps = 6/94 6%
Query  34   APGSEE-TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQT 92
            AP ++  TCG V   L  CL +++     P+  CC+G K +    KT   R  AC C++ 
Sbjct  20   APLTKAITCGQVTANLAQCLNYLRSGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKA 78
Query  93   AMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131
            A      ++      +P  CG+    +P  I  + +C ++
Sbjct  79   AAANTPGLNPSNAGSLPGKCGV---NIPYKISTSTNCASI 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.