The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE
PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP
IDVNMDCKTLGVLHYKGN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q40905 Par j 1 138 936 195.6 4e-52
O04404 Par j 1 176 820 172.4 4.8e-45
CAI94601 Par j 1.0103 139 660 140.3 1.8e-35
P43217 Par j 1 139 656 139.5 3.1e-35
CAA54587 Par j 1.0101 133 617 131.7 6.8e-33
P55958 Par j 2 133 471 102.4 4.4e-24
O04403 Par j 2 133 468 101.8 6.7e-24
A0A059STC4 Pun g 1.0101 120 248 57.7 1.1e-10
NP_001316123 Sola l 7.0101 115 246 57.3 1.5e-10
P82007 Hel a 3.0101 116 246 57.3 1.5e-10
A0A059SSZ0 Pun g 1.0201 120 246 57.3 1.5e-10
P93224 Sola l 3.0101 114 236 55.3 5.8e-10
AAB42069 Lyc e 3 114 236 55.3 5.8e-10
P19656-1 Zea m 14.0101 120 235 55.1 7e-10
P19656-2 Zea m 14.0102 128 235 55.1 7.4e-10
O04004 Amb a 6 118 232 54.5 1e-09
CAH69206 Tri tu 14.0101 115 221 52.3 4.7e-09
ACV04796 Api g 2 118 221 52.3 4.8e-09
QIN55516 Art ca 3.0102 117 220 52.1 5.5e-09
CAL07989 Pla a 3.0101 118 220 52.1 5.5e-09
ABY21307 Pla or 3.0101 118 216 51.3 9.6e-09
AAL25839 Hev b 12 116 215 51.1 1.1e-08
W0U0V5 Can s 3.0101 91 213 50.6 1.2e-08
A0AT29 Len c 3.0101 118 209 49.9 2.6e-08
ACE07187 Art v 3.0202 116 208 49.7 2.9e-08
ANC85020 Art ar 3.0102 116 208 49.7 2.9e-08
ANC85027 Art si 3.0102 116 208 49.7 2.9e-08
P85894 Mor n 3.0101 91 203 48.6 4.7e-08
A0A161AT60 Pis s 3.0101 120 204 48.9 5.2e-08
P81402 Pru p 3 91 202 48.4 5.4e-08
ANC85023 Art gm 3.0102 117 203 48.7 5.8e-08
EU564847 Art v 3.0301 117 202 48.5 6.7e-08
A0A059ST23 Pun g 1.0301 120 202 48.5 6.8e-08
ANC85025 Art la 3.0102 115 201 48.3 7.6e-08
ANC85017 Art an 3.0101 117 201 48.3 7.7e-08
ANC85021 Art ca 3.0101 117 201 48.3 7.7e-08
ABX56711 Ara h 9.0101 116 200 48.1 8.8e-08
ADC80503 Pha v 3.0201 118 200 48.1 8.9e-08
19846220 Tri a 14.0101 90 198 47.6 9.4e-08
CAB96876 Pru p 3 91 198 47.6 9.5e-08
ACN11576 Pru du 3.0101 123 199 47.9 1.1e-07
ANC85022 Art gm 3.0101 117 198 47.7 1.2e-07
Q8VX12 Fra a 3.0101 117 197 47.5 1.3e-07
ANC85026 Art si 3.0101 116 196 47.3 1.5e-07
AAA32970 Hor v 1 117 196 47.3 1.5e-07
ABU95411 Sin a 3.0101 92 194 46.8 1.7e-07
ABX75045 Ara h 9.0201 92 194 46.8 1.7e-07
CAA42832 Hor v 1 134 195 47.1 2e-07
P81651 Pru ar 3 91 191 46.2 2.5e-07
Q9M5X6 Pyr c 3 115 190 46.1 3.5e-07
EU564845 Art v 3.0201 114 189 45.9 4e-07
ANC85019 Art ar 3.0101 116 189 45.9 4e-07
ANC85024 Art la 3.0101 116 189 45.9 4e-07
ANC85018 Art an 3.0102 117 189 45.9 4.1e-07
Q4PLT9 Fra a 3.0102 117 187 45.5 5.4e-07
Q0Z8V0 Rub i 3.0101 117 186 45.3 6.2e-07
Q9M5X7 Mal d 3 115 183 44.7 9.2e-07
Q9M5X8 Pru av 3 117 183 44.7 9.4e-07
Q4PLU0 Fra a 3.0201 117 180 44.1 1.4e-06
AAK28533 Cor a 8 115 178 43.7 1.9e-06
Q4PLT6 Fra a 3.0202 117 175 43.1 2.9e-06
ADC80502 Pha v 3.0101 115 174 42.9 3.2e-06
P82534 Pru d 3 91 172 42.4 3.5e-06
XP_019446786 Lup an 3.0101 116 172 42.5 4.3e-06
A0A510A9S3 Ara h 17.0101 93 160 40.0 1.9e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 195.6 bits 936,  Expect = 4e-52
 Identities = 138/138 100%, Positives = 138/138 100%, Gaps = 0/138 0%
Query  1    MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE 60
            MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE
Sbjct  1    MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE 60
Query  61   PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP 120
            PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP
Sbjct  61   PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP 120
Query  121  IDVNMDCKTLGVLHYKGN 138
            IDVNMDCKTLGVLHYKGN
Sbjct  121  IDVNMDCKTLGVLHYKGN 138

Sequence Alignment: 2. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 172.4 bits 820,  Expect = 5e-45
 Identities = 125/133 93%, Positives = 127/133 95%, Gaps = 1/133 0%
Query  1    MRTVSARSSVALVVIVAAVLVWTSSASVAP-APAPGSEETCGTVVGALMPCLPFVQGKEK 59
            MRTVSA S+VALVVIVAA L WTS ASVAP APAPGSEETCGTVV ALMPCLPFVQGKEK
Sbjct  1    MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEK 60
Query  60   EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 119
            EPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP
Sbjct  61   EPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP 120
Query  120  PIDVNMDCKTLGVL 133
            PIDVNMDCKTLGV+
Sbjct  121  PIDVNMDCKTLGVV 134

Sequence Alignment: 3. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 140.3 bits 660,  Expect = 2e-35
 Identities = 93/97 95%, Positives = 96/97 98%, Gaps = 0/97 0%
Query  37   EETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 96
            +ETCGT+V ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  97   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVL 133
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGV+
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVV 97

Sequence Alignment: 4. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 139.5 bits 656,  Expect = 3e-35
 Identities = 92/97 94%, Positives = 96/97 98%, Gaps = 0/97 0%
Query  37   EETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 96
            +ETCGT+V ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
Sbjct  1    QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY 60
Query  97   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVL 133
            SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKT+GV+
Sbjct  61   SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTVGVV 97

Sequence Alignment: 5. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 131.7 bits 617,  Expect = 7e-33
 Identities = 87/91 95%, Positives = 90/91 98%, Gaps = 0/91 0%
Query  43   VVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 102
            +V ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
Sbjct  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
Query  103  LVSEVPKHCGIVDSKLPPIDVNMDCKTLGVL 133
            LVSEVPKHCGIVDSKLPPIDVNMDCKT+GV+
Sbjct  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVV 91

Sequence Alignment: 6. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 102.4 bits 471,  Expect = 4e-24
 Identities = 74/131 56%, Positives = 91/131 69%, Gaps = 6/131 4%
Query  1    MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE 60
            MRTV    S+A +V++AA L WTSSA  APAPAPG EE CG VV  +MPCL FV+G+EKE
Sbjct  1    MRTV----SMAALVVIAAALAWTSSAEPAPAPAPG-EEACGKVVQDIMPCLHFVKGEEKE 55
Query  61   PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP 120
            PSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK C I  + LPP
Sbjct  56   PSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDI-KTTLPP 114
Query  121  IDVNMDCKTLGVLHYKG 137
            I  + DC  +    ++G
Sbjct  115  ITADFDCSKIQSTIFRG 131

Sequence Alignment: 7. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 101.8 bits 468,  Expect = 7e-24
 Identities = 73/131 55%, Positives = 91/131 69%, Gaps = 6/131 4%
Query  1    MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE 60
            MRTV    S+A +V++AA L WTSSA +A APAPG E  CG VV  +MPCL FV+G+EKE
Sbjct  1    MRTV----SMAALVVIAAALAWTSSAELASAPAPG-EGPCGKVVHHIMPCLKFVKGEEKE 55
Query  61   PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPP 120
            PSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +LV+EVPK CGI  + LPP
Sbjct  56   PSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTT-LPP 114
Query  121  IDVNMDCKTLGVLHYKG 137
            I  + DC  +    ++G
Sbjct  115  ITADFDCSKIESTIFRG 131

Sequence Alignment: 8. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 57.7 bits 248,  Expect = 1e-10
 Identities = 38/98 38%, Positives = 57/98 58%, Gaps = 7/98 7%
Query  27   SVAPAPAPGSEE---TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRV 83
            +VA   AP + E   TCG V  +L PC+P+ +         CCSG K LDG  +T P R 
Sbjct  15   AVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQ 74
Query  84   HACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDC 127
              C+C+++A  + S I+  LV+ +P  CG+ +  K+ P   + DC
Sbjct  75   ATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISP---STDC 116

Sequence Alignment: 9. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 57.3 bits 246,  Expect = 1e-10
 Identities = 42/111 37%, Positives = 59/111 53%, Gaps = 10/111 9%
Query  11   ALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFV-QGKEKEPSKGCCSGA 69
            A+ ++V  VL     A VA         TCG V   L PC+PF+ QG E  P   CCSG 
Sbjct  3    AIAILVLVVLAVFQLAMVARGAI-----TCGQVDANLAPCVPFLTQGGE--PGAACCSGV 55
Query  70   KRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKT 129
            + L+G T++   R  AC C++ A   Y ++       +P  CGI  S   PI   ++C T
Sbjct  56   RTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGI--SLTVPISRTVNCDT 113
Query  130  L 130
            +
Sbjct  114  I 114

Sequence Alignment: 10. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 57.3 bits 246,  Expect = 1e-10
 Identities = 38/93 40%, Positives = 54/93 58%, Gaps = 4/93 4%
Query  34   PGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAM 93
            P    TC  V G L PCLP+++   K P+  CC+GAK+L G T+T   R  AC+C +TA 
Sbjct  23   PSVAITCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAA 81
Query  94   KTYSDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTL 130
                 +   + S +P  CGI  S   PI+ N++C T+
Sbjct  82   PQLK-VRPDMASSLPGKCGISTSI--PINPNVNCNTI 115

Sequence Alignment: 11. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 57.3 bits 246,  Expect = 2e-10
 Identities = 35/97 36%, Positives = 52/97 53%, Gaps = 4/97 4%
Query  28   VAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACE 87
            V  A    S  TCG V  +L PC+P+ +G    PS  CCSG + L+   KT P R  AC 
Sbjct  19   VVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACN 78
Query  88   CIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDC 127
            C++   ++ + I+   V  +P  CG+ +  K+ P   + DC
Sbjct  79   CLKVIARSITGINYGRVGALPGKCGVSIPYKISP---STDC 116

Sequence Alignment: 12. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 55.3 bits 236,  Expect = 6e-10
 Identities = 37/93 39%, Positives = 54/93 58%, Gaps = 7/93 7%
Query  33   APGSEE-TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQT 91
            AP +E  +CG V   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  92   AMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 130
            A  +   ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 13. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 55.3 bits 236,  Expect = 6e-10
 Identities = 37/93 39%, Positives = 54/93 58%, Gaps = 7/93 7%
Query  33   APGSEE-TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQT 91
            AP +E  +CG V   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++
Sbjct  19   APHAESLSCGEVTSGLAPCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
Query  92   AMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 130
            A  +   ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  77   AANSIKGIDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 14. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 55.1 bits 235,  Expect = 7e-10
 Identities = 40/107 37%, Positives = 63/107 58%, Gaps = 18/107 16%
Query  4    VSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSK 63
            V A + VALV++ AA    TS A++          +CG V  A+ PC+ + +G+   PS 
Sbjct  9    VVATAVVALVLLAAA----TSEAAI----------SCGQVASAIAPCISYARGQGSGPSA 54
Query  64   GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PID 122
            GCCSG + L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I 
Sbjct  55   GCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTIS 111
Query  123  VNMDC 127
             + DC
Sbjct  112  TSTDC 116

Sequence Alignment: 15. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 55.1 bits 235,  Expect = 7e-10
 Identities = 40/107 37%, Positives = 63/107 58%, Gaps = 18/107 16%
Query  4    VSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSK 63
            V A + VALV++ AA    TS A++          +CG V  A+ PC+ + +G+   PS 
Sbjct  9    VVATAVVALVLLAAA----TSEAAI----------SCGQVASAIAPCISYARGQGSGPSA 54
Query  64   GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PID 122
            GCCSG + L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I 
Sbjct  55   GCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTIS 111
Query  123  VNMDC 127
             + DC
Sbjct  112  TSTDC 116

Sequence Alignment: 16. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 54.5 bits 232,  Expect = 1e-09
 Identities = 37/90 41%, Positives = 49/90 54%, Gaps = 4/90 4%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC TV   L PC  F+ G+E  PSK CC+G   L+   KT   RV  C CI+   K+ + 
Sbjct  29   TCDTVQNILAPCAGFLTGQE--PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA- 85
Query  99   IDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGV 132
             D K +  +   CG V   +P +D N+DC  L V
Sbjct  86   YDPKRMPLLSTKCG-VKPDFPAVDKNLDCSKLPV 118

Sequence Alignment: 17. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 52.3 bits 221,  Expect = 5e-09
 Identities = 40/110 36%, Positives = 64/110 58%, Gaps = 17/110 15%
Query  5    SARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKG 64
            SA + V LV +VAA+L+  + A+V          +CG V  AL PC+ + +G    PS  
Sbjct  4    SAVAQVVLVAVVAAMLLAVTEAAV----------SCGQVSSALSPCISYARGNGASPSAA 53
Query  65   CCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDV 123
            CCSG + L    ++   +  AC+CI++A    +   GK    +P  CG+    +P  I  
Sbjct  54   CCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--GKAAG-IPTKCGV---SVPYAISS 107
Query  124  NMDCKTL 130
            ++DC  +
Sbjct  108  SVDCSKI 114

Sequence Alignment: 18. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 52.3 bits 221,  Expect = 5e-09
 Identities = 43/110 39%, Positives = 60/110 54%, Gaps = 11/110 10%
Query  8    SSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCS 67
            S VA+ V V  ++V  +     PA   G   TCG V G L  CL +++G    PS  CC 
Sbjct  4    SKVAIAVAVMLMVVVINH----PAVVEG--LTCGQVTGKLGGCLGYLKGG-GYPSPACCG 56
Query  68   GAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMD 126
            G K L+   KT   R +AC C++T   +   I+    S +P  CGI   ++P PI  + D
Sbjct  57   GVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGI---RIPYPISPSTD 113
Query  127  C 127
            C
Sbjct  114  C 114

Sequence Alignment: 19. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 52.1 bits 220,  Expect = 5e-09
 Identities = 32/88 36%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PCL F++   + P+  CC+G K L+   KTGP R  AC C++T  K+  D
Sbjct  28   TCSDVSNKITPCLSFLKQGGEVPAD-CCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKD 86
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            +       +P  CG+    +P  I +  DC T+
Sbjct  87   LKSDNAVVLPSKCGV---NIPYKISLETDCNTV 116

Sequence Alignment: 20. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 52.1 bits 220,  Expect = 6e-09
 Identities = 40/95 42%, Positives = 54/95 56%, Gaps = 7/95 7%
Query  28   VAPAPAPGSEETCGTVVGALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHAC 86
            VA AP   +  TCGTVV  L PCL F++ G    P+  CC+G K L+ + KT P R  AC
Sbjct  18   VATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAAC 75
Query  87   ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
             C++TA  + S I     + +   CG+    LP  I   +DC
Sbjct  76   GCLKTASTSISGIQLGNAASLAGKCGV---NLPYKISPTIDC 114

Sequence Alignment: 21. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 51.3 bits 216,  Expect = 1e-08
 Identities = 39/95 41%, Positives = 54/95 56%, Gaps = 7/95 7%
Query  28   VAPAPAPGSEETCGTVVGALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHAC 86
            VA AP   +  TCGTVV  L PCL +++ G    P+  CC+G K L+ + KT P R  AC
Sbjct  18   VATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAAC 75
Query  87   ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
             C++TA  + S I     + +   CG+    LP  I   +DC
Sbjct  76   GCLKTASTSISGIQLGNAASLAGKCGV---NLPYKISPTIDC 114

Sequence Alignment: 22. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 51.1 bits 215,  Expect = 1e-08
 Identities = 30/97 30%, Positives = 53/97 54%, Gaps = 4/97 4%
Query  31   APAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQ 90
            AP      TCG V  AL+PCL +++     P   CC+G + ++   KT   R  AC+C++
Sbjct  18   APMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLK 77
Query  91   TAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            +A  +   ++   V+ +P  CG+    +P  I ++ +C T+
Sbjct  78   SAAGSVKGLNPTTVAGLPGKCGV---NIPYKISLSTNCATV 115

Sequence Alignment: 23. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 50.6 bits 213,  Expect = 1e-08
 Identities = 31/88 35%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  99   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 130
            ++  L S +P  CG+ +  K+ P   + DC ++
Sbjct  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90

Sequence Alignment: 24. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 49.9 bits 209,  Expect = 3e-08
 Identities = 32/99 32%, Positives = 49/99 49%, Gaps = 5/99 5%
Query  28   VAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACE 87
            V  AP      +CG V   L PCL ++ G    PS  CC G K+L     T P R  AC 
Sbjct  17   VVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACN 75
Query  88   CIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            C+++A  + + ++    + +P  CG+    +P  I    +C T+
Sbjct  76   CLKSAAGSITKLNTNNAAALPGKCGV---NIPYKISTTTNCNTV 116

Sequence Alignment: 25. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 49.7 bits 208,  Expect = 3e-08
 Identities = 29/85 34%, Positives = 48/85 56%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            +   + + +P  CG+    +P  I +  DC
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 26. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 49.7 bits 208,  Expect = 3e-08
 Identities = 29/85 34%, Positives = 48/85 56%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            +   + + +P  CG+    +P  I +  DC
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 27. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 49.7 bits 208,  Expect = 3e-08
 Identities = 29/85 34%, Positives = 48/85 56%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D
Sbjct  27   TCSDVSNKITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            +   + + +P  CG+    +P  I +  DC
Sbjct  86   LKSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 28. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 48.6 bits 203,  Expect = 5e-08
 Identities = 29/88 32%, Positives = 51/88 57%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V  +L PC+ +++     P+  CC+G + L+   KT   R  AC C+++A  +   
Sbjct  2    TCGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  99   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 130
            ++  L + +P  CG+ V  K+ P   + DCK++
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISP---STDCKSV 90

Sequence Alignment: 29. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 48.9 bits 204,  Expect = 5e-08
 Identities = 30/100 30%, Positives = 51/100 51%, Gaps = 5/100 5%
Query  28   VAPAPAPGSEETCGTVVGALMPCLPFVQGKEKE-PSKGCCSGAKRLDGETKTGPQRVHAC 86
            V  AP   +  +CGTV   + PC+ ++Q      P   CC+G K+L     T P R  AC
Sbjct  17   VVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAAC 76
Query  87   ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
             C+++A  +   ++    + +P  CG+    +P  I  + +C T+
Sbjct  77   NCLKSAAGSIPKLNTNNAAALPGKCGV---SIPYKISTSTNCNTV 118

Sequence Alignment: 30. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 48.4 bits 202,  Expect = 5e-08
 Identities = 28/88 31%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V  AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90

Sequence Alignment: 31. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 48.7 bits 203,  Expect = 6e-08
 Identities = 36/105 34%, Positives = 54/105 51%, Gaps = 10/105 9%
Query  14   VIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLD 73
            V    V+    S+S A A       TC  V   + PCL F++   + P+  CC+G K L+
Sbjct  8    VFCVMVVCMVVSSSYAEAAL-----TCSDVSNKISPCLSFLKQGGEVPAD-CCTGVKGLN 61
Query  74   GETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               KT P R  AC C++T+ K+  D+       +P  CG+    +P  I +  DC
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 32. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 48.5 bits 202,  Expect = 7e-08
 Identities = 31/88 35%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  36   SEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKT 95
            S  TC  V   + PCL +++ K  E    CC+G K L+  TKT P R  AC C++ + K+
Sbjct  25   SALTCSDVSTKISPCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKS 83
Query  96   YSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
              D+   +   +P  CG+    LP  + +  DC
Sbjct  84   NKDLKSDFAVPLPSKCGL---NLPYKLSLETDC 113

Sequence Alignment: 33. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 48.5 bits 202,  Expect = 7e-08
 Identities = 30/87 34%, Positives = 47/87 54%, Gaps = 3/87 3%
Query  39   TCGTVVGALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 97
            TCG V  +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S
Sbjct  29   TCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSIS 88
Query  98   DIDGKLVSEVPKHCGI-VDSKLPPIDVNMD 126
             I+  LV+  P  CG+ +  K+ P   N D
Sbjct  89   GINYGLVAGAPGKCGVSIPYKIAP-STNCD 117

Sequence Alignment: 34. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 48.3 bits 201,  Expect = 8e-08
 Identities = 30/85 35%, Positives = 46/85 54%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PCL +++ K  E    CC+G K L+  TKT P R  AC C++ + K+  D
Sbjct  26   TCSDVSTKISPCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 84
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            +   +   +P  CG+    LP  + +  DC
Sbjct  85   LKSDFAVPLPSKCGL---NLPYKLSLETDC 111

Sequence Alignment: 35. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 48.3 bits 201,  Expect = 8e-08
 Identities = 36/105 34%, Positives = 52/105 49%, Gaps = 10/105 9%
Query  14   VIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLD 73
            V    V+    S+S A A       TC  V   ++PC  F++ +  E S  CC+G K L+
Sbjct  8    VFCVMVVCMVVSSSYAEAAL-----TCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLN 61
Query  74   GETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               KT P R  AC C++T  K+  D        +P  CG+    +P  I +  DC
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 36. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 48.3 bits 201,  Expect = 8e-08
 Identities = 36/105 34%, Positives = 52/105 49%, Gaps = 10/105 9%
Query  14   VIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLD 73
            V    V+    S+S A A       TC  V   ++PC  F++ +  E S  CC+G K L+
Sbjct  8    VFCVMVVCMVVSSSYAEAAL-----TCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLN 61
Query  74   GETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               KT P R  AC C++T  K+  D        +P  CG+    +P  I +  DC
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 37. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 48.1 bits 200,  Expect = 9e-08
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            +CG V  AL PC+PF+  K   P   CCSG + L G  +T   R  AC C++ A  +   
Sbjct  26   SCGQVNSALAPCIPFLT-KGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  85   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 114

Sequence Alignment: 38. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 48.1 bits 200,  Expect = 9e-08
 Identities = 32/115 27%, Positives = 54/115 46%, Gaps = 5/115 4%
Query  12   LVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKR 71
            +  + +A +V      V  AP   +  +CG V  +L  C+PF+      P+  CCSG + 
Sbjct  1    MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPAS-CCSGVRS 59
Query  72   LDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            L+   KT P R   C C+++A       +      +P  CG+    +P  I  + +C T+
Sbjct  60   LNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGV---SIPYKISTSTNCATI 116

Sequence Alignment: 39. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 47.6 bits 198,  Expect = 9e-08
 Identities = 29/84 34%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  40   CGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 99
            CG V   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
Query  100  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            +      +P  CG+    LP  I +N+DC
Sbjct  62   NEDNARSIPPKCGV---NLPYTISLNIDC 87

Sequence Alignment: 40. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 47.6 bits 198,  Expect = 9e-08
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V  +L PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  2    TCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---SIPYKISASTNCATV 90

Sequence Alignment: 41. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 47.9 bits 199,  Expect = 1e-07
 Identities = 39/116 33%, Positives = 61/116 52%, Gaps = 11/116 9%
Query  8    SSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFV-QGKEKEPSKGCC 66
            SS  L+ +V  V V    A     P   +  +CG VV  L PC+ +V  G    PS  CC
Sbjct  3    SSGQLLKLVCLVAVMCCMA--VGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPS--CC 58
Query  67   SGAKRLDGETKTGPQRVHACECIQTAMK--TYSDIDGKLVSEVPKHCGI-VDSKLPPIDV 123
            +G + L    +T   R   C C++ A+    Y++ +  L + +P  CG+ +  K+ P   
Sbjct  59   TGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISP--- 115
Query  124  NMDCKTL 130
            + DCKT+
Sbjct  116  STDCKTI 122

Sequence Alignment: 42. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 47.7 bits 198,  Expect = 1e-07
 Identities = 35/105 33%, Positives = 53/105 50%, Gaps = 10/105 9%
Query  14   VIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLD 73
            V    V+    S+S A A       TC  V   + PC  F++   + P+  CC+G K L+
Sbjct  8    VFCVMVVCMVVSSSYAEAAL-----TCSDVSNKISPCTSFLKQGGEVPAD-CCTGVKGLN 61
Query  74   GETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               KT P R  AC C++T+ K+  D      + +P  CG+    +P  I +  DC
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 43. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 47.5 bits 197,  Expect = 1e-07
 Identities = 36/110 32%, Positives = 57/110 51%, Gaps = 11/110 10%
Query  8    SSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCS 67
            SS A+ + + A+L    +  +A A       TCG V   + PCL +V+     P+  CCS
Sbjct  3    SSTAMKLSLVALLCIVVALPIAQAI------TCGQVASNISPCLTYVKSGGAVPA-ACCS 55
Query  68   GAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMD 126
            G + L+G  KT   R  AC C++ A      ++  L + +P  CG+    +P  I    +
Sbjct  56   GIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGV---SVPYKISTTTN 112
Query  127  C 127
            C
Sbjct  113  C 113

Sequence Alignment: 44. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 47.3 bits 196,  Expect = 2e-07
 Identities = 28/85 32%, Positives = 45/85 52%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D
Sbjct  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            +       +P  CG+    +P  + +  DC
Sbjct  86   LKSDYAVPLPSKCGVT---IPYKLSMETDC 112

Sequence Alignment: 45. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 47.3 bits 196,  Expect = 2e-07
 Identities = 33/112 29%, Positives = 57/112 50%, Gaps = 9/112 8%
Query  11   ALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAK 70
            A V+++AA LV   +A    AP       CG V   + PCL +VQG    PS  CC+G +
Sbjct  4    AQVLLMAAALVLMLTA----APRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVR 58
Query  71   RLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKT 129
             L  + ++   R   C C++   +   +++    + +P  C + V   + P   ++DC  
Sbjct  59   DLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISP---DIDCSR 115
Query  130  L 130
            +
Sbjct  116  I 116

Sequence Alignment: 46. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 46.8 bits 194,  Expect = 2e-07
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            +CGTV   L  C+ ++      P KGCC+G   L+   +T P R +AC C+  A  ++  
Sbjct  3    SCGTVNSNLAACIGYLTQNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +PK CG+    +P  I  + +C ++
Sbjct  62   LNAARAAALPKACGV---NIPYKISKSTNCNSV 91

Sequence Alignment: 47. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 46.8 bits 194,  Expect = 2e-07
 Identities = 31/88 35%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            +CG V  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90

Sequence Alignment: 48. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 47.1 bits 195,  Expect = 2e-07
 Identities = 33/109 30%, Positives = 56/109 51%, Gaps = 9/109 8%
Query  11   ALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAK 70
            A V+++AA LV   +A    AP       CG V   + PCL +VQG    PS  CC+G +
Sbjct  4    AQVLLMAAALVLMLTA----APRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVR 58
Query  71   RLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
             L  + ++   R   C C++   +   +++    + +P  C +    +P  I  ++DC
Sbjct  59   DLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNV---NVPYTISPDIDC 113

Sequence Alignment: 49. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 46.2 bits 191,  Expect = 3e-07
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V  +L PC+ +V+G    P   CC+G + ++   +T P R  AC C++    + S 
Sbjct  2    TCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---NIPYKISASTNCATV 90

Sequence Alignment: 50. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 46.1 bits 190,  Expect = 3e-07
 Identities = 35/108 32%, Positives = 56/108 51%, Gaps = 11/108 10%
Query  13   VVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRL 72
            V+ +A V+    + SVA A       TC  V   L PC+ +V+     P   CC+G K +
Sbjct  6    VIKLALVVALCMAVSVAHAI------TCSQVSANLAPCINYVRSGGAVPP-ACCNGIKTI 58
Query  73   DGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            +G  KT P R  AC C++    + S ++      +P  CG+    +P  I  + +C T+
Sbjct  59   NGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 51. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 45.9 bits 189,  Expect = 4e-07
 Identities = 27/84 32%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  40   CGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 99
            C  V   +  CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D 
Sbjct  26   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 84
Query  100  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               + + +P  CG+    +P  I +  DC
Sbjct  85   KSDFAASLPSKCGV---NIPYKISLETDC 110

Sequence Alignment: 52. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 45.9 bits 189,  Expect = 4e-07
 Identities = 27/84 32%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  40   CGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 99
            C  V   +  CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D 
Sbjct  28   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  100  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               + + +P  CG+    +P  I +  DC
Sbjct  87   KSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 53. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 45.9 bits 189,  Expect = 4e-07
 Identities = 27/84 32%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  40   CGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 99
            C  V   +  CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D 
Sbjct  28   CSDVSNKISACLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDF 86
Query  100  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               + + +P  CG+    +P  I +  DC
Sbjct  87   KSDFAASLPSKCGV---NIPYKISLETDC 112

Sequence Alignment: 54. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 45.9 bits 189,  Expect = 4e-07
 Identities = 29/85 34%, Positives = 46/85 54%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TC  V   + PC  F++ K  E    CC+G K L+   KT P R  AC C++T+ K+ ++
Sbjct  28   TCNDVTKKISPCTSFLE-KGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNN 86
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
               +  + +P  CG+    +P  I +  DC
Sbjct  87   FKEENAAVLPSKCGV---NIPYKISLETDC 113

Sequence Alignment: 55. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 45.5 bits 187,  Expect = 5e-07
 Identities = 34/110 30%, Positives = 56/110 50%, Gaps = 11/110 10%
Query  8    SSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCS 67
            SS A+ + + A+L    +  +A A       TCG V   + PC+ +V+     P+  CCS
Sbjct  3    SSTAMKLSLVALLCIVVALPIAQAI------TCGQVASNISPCVTYVKSGGAVPAP-CCS 55
Query  68   GAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMD 126
            G + L+G  KT   R   C C++ A      ++  L + +P  CG+    +P  I    +
Sbjct  56   GIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGV---SVPYKISTTTN 112
Query  127  C 127
            C
Sbjct  113  C 113

Sequence Alignment: 56. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 45.3 bits 186,  Expect = 6e-07
 Identities = 26/88 29%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V   + PC+ +V+     P+  CC+G + L+ + KT   R + C C++ A  +   
Sbjct  28   TCGQVTQNVAPCFNYVKNGGAVPA-ACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG 86
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++  L + +P  CG+    +P  I  + +C T+
Sbjct  87   LNPSLAAGLPGKCGV---SVPYKISTSTNCATV 116

Sequence Alignment: 57. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 44.7 bits 183,  Expect = 9e-07
 Identities = 35/112 31%, Positives = 62/112 55%, Gaps = 14/112 12%
Query  6    ARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGC 65
            A S+V  + +V A+ +   + SVA A       TCG V  +L PC+ +V+     P   C
Sbjct  2    ASSAVTKLALVVALCM---AVSVAHAI------TCGQVTSSLAPCIGYVRSGGAVPP-AC 51
Query  66   CSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVN 124
            C+G + ++G  +T   R  AC C++    + S ++    + +P  CG+    +P  I  +
Sbjct  52   CNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV---NVPYKISTS 108
Query  125  MDCKTL 130
             +C T+
Sbjct  109  TNCATV 114

Sequence Alignment: 58. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 44.7 bits 183,  Expect = 9e-07
 Identities = 37/112 33%, Positives = 61/112 54%, Gaps = 15/112 13%
Query  5    SARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKG 64
            SA + +ALVV +  V+    S  +A A       TCG V   L PC+ +V+G    P   
Sbjct  4    SAMTKLALVVALCMVV----SVPIAQA------LTCGQVSSNLAPCIAYVRGGGAVPP-A 52
Query  65   CCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDV 123
            CC+G + ++   KT   R  AC C++    +   ++    + +P  CG+ V  K+ P   
Sbjct  53   CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISP--- 109
Query  124  NMDCKTL 130
            + +C T+
Sbjct  110  STNCATV 116

Sequence Alignment: 59. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 44.1 bits 180,  Expect = 1e-06
 Identities = 32/110 29%, Positives = 57/110 51%, Gaps = 11/110 10%
Query  8    SSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCS 67
            SS A+ + + A+L    +  +A A       TCG V  ++ PC+ +V+     P+  CC+
Sbjct  3    SSTAMKLSLVALLCIVVALPIAQAI------TCGQVASSISPCVNYVKSGGAVPA-ACCN 55
Query  68   GAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMD 126
            G + L+   KT   R   C C++ A      ++  L + +P  CG+    +P  I  + +
Sbjct  56   GIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGV---SVPYKISTSTN 112
Query  127  C 127
            C
Sbjct  113  C 113

Sequence Alignment: 60. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 43.7 bits 178,  Expect = 2e-06
 Identities = 30/100 30%, Positives = 54/100 54%, Gaps = 8/100 8%
Query  15   IVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQ-GKEKEPSKGCCSGAKRLD 73
            +V AVL+      +  AP   +  TC  + G L PC+ +++ G    PS  CC G + ++
Sbjct  6    LVCAVLL----CMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS--CCKGVRAVN 59
Query  74   GETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPP 120
              ++T   R  AC C++   K  + ++  L + +P  CG+ +  K+ P
Sbjct  60   DASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISP 107

Sequence Alignment: 61. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 43.1 bits 175,  Expect = 3e-06
 Identities = 25/85 29%, Positives = 44/85 51%, Gaps = 5/85 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V  ++ PC+ +V+     P+  CC+G + L+   KT   R   C C++ A      
Sbjct  28   TCGQVASSISPCVNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG 86
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127
            ++  L + +P  CG+    +P  I  + +C
Sbjct  87   LNPNLAAGLPGKCGV---NVPYKISTSTNC 113

Sequence Alignment: 62. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 42.9 bits 174,  Expect = 3e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V   L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      
Sbjct  26   TCGQVQSNLVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++      +P  CG+    +P  I  + +C ++
Sbjct  85   LNPNNAQALPGKCGV---NIPYKISTSTNCASI 114

Sequence Alignment: 63. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 42.4 bits 172,  Expect = 4e-06
 Identities = 25/88 28%, Positives = 45/88 51%, Gaps = 5/88 5%
Query  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
            TCG V   L PC+ +V+G    P   CC+G + ++   +T   R  AC C++    +   
Sbjct  2    TCGQVSSNLAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  61   VNPNNAAALPGKCGV---NVPYKISASTNCATV 90

Sequence Alignment: 64. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 42.5 bits 172,  Expect = 4e-06
 Identities = 33/111 29%, Positives = 54/111 48%, Gaps = 9/111 8%
Query  12   LVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKR 71
            +V +  AVL+      V  AP   +  TCG V   L  CL +++     P+  CC+G K 
Sbjct  4    IVKLACAVLI---CMVVVSAPLTKAI-TCGQVTANLAQCLNYLRSGGAVPAP-CCNGIKN 58
Query  72   LDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            +    KT P R  AC C++ A      ++      +P  CG+    +P  I  + +C ++
Sbjct  59   ILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV---NIPYKISTSTNCASI 115

Sequence Alignment: 65. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 40.0 bits 160,  Expect = 2e-05
 Identities = 25/85 29%, Positives = 48/85 56%, Gaps = 10/85 11%
Query  40   CGTVVGALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY- 96
            C  V  ++ PC+ +++  G    P   CCSG + ++G  KT   R   C C+++A  +  
Sbjct  4    CSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  97   SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130
            S I+    + +P  CG+    +P  I  +++C ++
Sbjct  61   SQINPNNAASLPGKCGV---SIPYKISTSINCSSI 92

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.