The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSCIAVEAVLLGILLYIPIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTA
EGQTKVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFY
GEDPNNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAAL
RISGDKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPG
DQPAIITAQARKTDSEDTGYYFVNCRVTGGGAFLGRSWMPAAKVVFAYTEMVDAIHPEGW
ILVKPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPPRV
VGLP
Sequence Info Allergen Name Length Opt Bits Score E Value
ACZ57582 Ole e 11.0101 364 2399 553.3 6.1e-159
AAX11262 Sal k 1.0301 339 1317 306.6 9.9e-85
AAT99258 Sal k 1.0201 362 1299 302.5 1.8e-83
AAX11261 Sal k 1.0302 339 1296 301.9 2.7e-83
P85076 Act d 7.0101 321 329 81.5 5.8e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 11.0101 Sequence ID: ACZ57582

 Score = 553.3 bits 2399,  Expect = 6e-159
 Identities = 364/364 100%, Positives = 364/364 100%, Gaps = 0/364 0%
Query  1    MSCIAVEAVLLGILLYIPIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTA 60
            MSCIAVEAVLLGILLYIPIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTA
Sbjct  1    MSCIAVEAVLLGILLYIPIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTA 60
Query  61   EGQTKVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFY 120
            EGQTKVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFY
Sbjct  61   EGQTKVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFY 120
Query  121  GEDPNNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAAL 180
            GEDPNNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAAL
Sbjct  121  GEDPNNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAAL 180
Query  181  RISGDKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPG 240
            RISGDKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPG
Sbjct  181  RISGDKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPG 240
Query  241  DQPAIITAQARKTDSEDTGYYFVNCRVTGGGAFLGRSWMPAAKVVFAYTEMVDAIHPEGW 300
            DQPAIITAQARKTDSEDTGYYFVNCRVTGGGAFLGRSWMPAAKVVFAYTEMVDAIHPEGW
Sbjct  241  DQPAIITAQARKTDSEDTGYYFVNCRVTGGGAFLGRSWMPAAKVVFAYTEMVDAIHPEGW 300
Query  301  ILVKPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPPRV 360
            ILVKPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPPRV
Sbjct  301  ILVKPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPPRV 360
Query  361  VGLP 364
            VGLP
Sbjct  361  VGLP 364

Sequence Alignment: 2. Allergen Name: Sal k 1.0301 Sequence ID: AAX11262

 Score = 306.6 bits 1317,  Expect = 1e-84
 Identities = 196/331 59%, Positives = 251/331 75%, Gaps = 5/331 1%
Query  27   PIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTAE-GQTKVIKLKSDGSGDFKSINEAIK 85
            PIP N A+L SWF G ++PV+ +K  ++P++V AE G  + I+++ DGSG FK+I++A+K
Sbjct  2    PIPPNPAELESWFQGAVKPVSEQKG-LEPSVVQAESGGVETIEVRQDGSGKFKTISDAVK 60
Query  86   SIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDPNNMPILVFGGTAAEYGTVDSA 145
             +   NTKRVI+++ PG Y EKVKI     YIT+YG DP N P + F GTAAE+GTVDSA
Sbjct  61   HVKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSA 120
Query  146  TLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISGDKASFYNVKIYGFQDTLCDDK 205
            TLIVES+YF   NL + NSAPRPDGKR GA+A+ALRISGD+A+FYN K  GFQDT+CDDK
Sbjct  121  TLIVESDYFVGANLIVSNSAPRPDGKRKGARASALRISGDRAAFYNCKFTGFQDTVCDDK 180
Query  206  GKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPAIITAQARKTDSEDTGYYFVNC 265
            G H++KDCYIEGTVDFIFG  +S++LNTELH VPGD  A+ITA+ARK      GY FV+C
Sbjct  181  GNHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHC 240
Query  266  RVTGGG--AFLGRSWMPAAKVVFAYTEMVDAIHPEGWILV-KPEHESTVRFSEYNNKGPG 322
            +VTG G  A+LGR+W  AA+VVF+Y  + DA+ PEGW    KP  + T+ F EY N GPG
Sbjct  241  KVTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSDNNKPAAQKTIFFGEYKNTGPG 300
Query  323  ANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPP 358
            A  +KR  + K+L++A+AK   SL  IEA+KWLLPP
Sbjct  301  AAADKRVPYTKQLTEADAKTFTSLEYIEAAKWLLPP 336

Sequence Alignment: 3. Allergen Name: Sal k 1.0201 Sequence ID: AAT99258

 Score = 302.5 bits 1299,  Expect = 2e-83
 Identities = 199/351 56%, Positives = 257/351 73%, Gaps = 6/351 1%
Query  6    VEAVLLGILLYIPIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTAE-GQT 64
            V  +L+G +L I I ++     IP N A+L SWF G ++PV+ +K  ++P++V  E G  
Sbjct  5    VSMLLVGFVL-INIAFTSIAQLIPPNPAELESWFQGAVKPVSEQKG-LEPSVVQTESGGV 62
Query  65   KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDP 124
            + I+++ DGSG FK+I++A+K +   NTKRVI+++ PG Y EKVKI     YIT+YG DP
Sbjct  63   ETIEVRQDGSGKFKTISDAVKHVKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDP 122
Query  125  NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG 184
             N P + F GTAAE+GTVDSAT+IVES+Y    +L + NSAPRPDGKR GAQA ALRISG
Sbjct  123  KNRPTITFAGTAAEFGTVDSATVIVESDYSVGAHLIVTNSAPRPDGKRKGAQAGALRISG 182
Query  185  DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA 244
            D+A+FYN K  GFQDT+CDDKG HF+ DCY EGTVDFIFG  +S++LNTELH VPGD  A
Sbjct  183  DRAAFYNCKFTGFQDTVCDDKGNHFFTDCYTEGTVDFIFGEARSLYLNTELHVVPGDPMA 242
Query  245  IITAQARKTDSEDTGYYFVNCRVTGGG--AFLGRSWMPAAKVVFAYTEMVDAIHPEGWIL 302
            +ITA+ARK      GY FV+C+VTG G  A+LGR+W  AA+VVF+Y  + DA  PEGW  
Sbjct  243  MITAHARKNADGVGGYSFVHCKVTGTGGTALLGRAWFDAARVVFSYCNLSDAAKPEGWSD 302
Query  303  V-KPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPP 358
              KPE + T+ F EY N GPGA  +KRA + K+L++A+AK   SL  IEA+KWLLPP
Sbjct  303  NNKPEAQKTILFGEYKNTGPGAAPDKRAPYTKQLTEADAKTFTSLEYIEAAKWLLPP 359

Sequence Alignment: 4. Allergen Name: Sal k 1.0302 Sequence ID: AAX11261

 Score = 301.9 bits 1296,  Expect = 3e-83
 Identities = 194/331 58%, Positives = 249/331 75%, Gaps = 5/331 1%
Query  27   PIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTAE-GQTKVIKLKSDGSGDFKSINEAIK 85
            PIP N A+L SWF G ++PV+ +K  ++P++V AE G  + I+++ DGSG FK+I++A+K
Sbjct  2    PIPPNPAELESWFQGAVKPVSEQKG-LEPSVVQAESGGVETIEVRQDGSGKFKTISDAVK 60
Query  86   SIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDPNNMPILVFGGTAAEYGTVDSA 145
             +   NTKRVI+++ PG Y EKVKI     YIT+YG DP N P + F GTAAE+GTVDSA
Sbjct  61   HVKVGNTKRVIITIGPGEYREKVKIEGLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSA 120
Query  146  TLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISGDKASFYNVKIYGFQDTLCDDK 205
            TLIVES+YF   NL + NSAPRP GKR GAQA+ALRISGD+A+FYN K  GFQDT+CDDK
Sbjct  121  TLIVESDYFVGANLIVSNSAPRPAGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDK 180
Query  206  GKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPAIITAQARKTDSEDTGYYFVNC 265
            G H++KDCYIEGTVD+IFG  +S++LNTELH VPGD  A+ITA+ARK      GY FV+C
Sbjct  181  GNHLFKDCYIEGTVDLIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHC 240
Query  266  RVTGGG--AFLGRSWMPAAKVVFAYTEMVDAIHPEGWILV-KPEHESTVRFSEYNNKGPG 322
            +VTG G  A+LGR+W  AA+VVF+Y  + DA+ PEGW    KP  + T+ F EY N GPG
Sbjct  241  KVTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSDNNKPAAQKTIFFGEYKNTGPG 300
Query  323  ANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPP 358
            A  +KR  + K+L++A+AK   SL  IEA+KWL PP
Sbjct  301  AAADKRVPYTKQLTEADAKTFTSLEYIEAAKWLPPP 336

Sequence Alignment: 5. Allergen Name: Act d 7.0101 Sequence ID: P85076

 Score = 81.5 bits 329,  Expect = 6e-17
 Identities = 90/283 31%, Positives = 146/283 51%, Gaps = 23/283 8%
Query  67   IKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDPNN 126
            + +  DGSG+F ++  A+ +  D +T R ++ +  G Y E V +   K  + F G+    
Sbjct  10   VVVAKDGSGNFTTVGAAVAAAKDSSTARFVIYIKEGAYFEYVDVDKKKTNLMFIGDGIGK 69
Query  127  MPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISGDK 186
              I         + T  S+T+ V    F A  +   N A  P       QA ALR   D 
Sbjct  70   TWIKGNRSVVDGWTTFRSSTVAVVGTGFIARGISFENYAG-PSKH----QAVALRSGADF 124
Query  187  ASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAV-PGD-QPA 244
            ++FY     G+QDTL     ++FY +C + GT+DFIFG+  +++    L+A  P + Q  
Sbjct  125  SAFYQCSFVGYQDTLYVHSLRQFYSECDVYGTIDFIFGNAAAVLQKCNLYARKPNENQKN 184
Query  245  IITAQARKTDSEDTGYYFVNCRVTGGG----------AFLGRSWMPAAKVVFAYTEMVDA 294
            I TAQ R   +++TG   +NC+V               +LGR W   ++ VF  ++M   
Sbjct  185  IFTAQGRDDPNQNTGISILNCKVAAAADLIPVLSSFKTYLGRPWKEYSRTVFLLSQMESL 244
Query  295  IHPEGWILVKPEHE-STVRFSEYNNKGPGANMEKRAK---FVKRLSDAEAKQSISLGS-I 349
            I P GW+    +   +T+ + EY N GPG+N   R     +    ++ E  Q  ++G+ I
Sbjct  245  IDPAGWLEWSGDFALTTLYYREYKNTGPGSNTTARVTWPGYAVTTNETEVIQ-FTVGNFI 303
Query  350  EASKWL 355
            + S+WL
Sbjct  304  QGSQWL 309

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.