The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPV
CSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFS
KSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL
Sequence Info Allergen Name Length Opt Bits Score E Value
O43099 Asp f 3 168 1122 262.8 3.5e-72
AAD42074 Pen c 3 167 905 213.4 2.7e-57
P56577 Mala f 2 177 443 108.0 1.5e-25
CAA09883 Mala s 5 172 428 104.6 1.5e-24
P56578 Mala f 3 166 408 100.1 3.4e-23
AAA34358 Cand b 2 167 326 81.4 1.4e-17
AAA34357 Cand b 2 167 320 80.0 3.7e-17
AAQ74769 Tri a 32.0101 218 116 33.4 0.0053
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asp f 3 Sequence ID: O43099

 Score = 262.8 bits 1122,  Expect = 4e-72
 Identities = 168/168 100%, Positives = 168/168 100%, Gaps = 0/168 0%
Query  1    MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPV 60
            MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPV
Sbjct  1    MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPV 60
Query  61   CSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFS 120
            CSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFS
Sbjct  61   CSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFS 120
Query  121  KSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL 168
            KSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL
Sbjct  121  KSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL 168

Sequence Alignment: 2. Allergen Name: Pen c 3 Sequence ID: AAD42074

 Score = 213.4 bits 905,  Expect = 3e-57
 Identities = 136/165 82%, Positives = 149/165 90%, Gaps = 0/165 0%
Query  4    LKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSA 63
            LKAGDSFP  V FSYIPW+ED  EIT+CGIPINYNASKE+A+KKV+LFALPGAFTPVCSA
Sbjct  3    LKAGDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSA 62
Query  64   RHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSI 123
             HVPEYI+KLPE+RAKGVD VAVLAYNDAYVMSAWGKAN VTGDDILFLSDP+A+FSKSI
Sbjct  63   NHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSKSI 122
Query  124  GWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL 168
            GWADEEGRT RY LVID+GKI YAA E AKN LE+S A+ VLK+L
Sbjct  123  GWADEEGRTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL 167

Sequence Alignment: 3. Allergen Name: Mala f 2 Sequence ID: P56577

 Score = 108.0 bits 443,  Expect = 1e-25
 Identities = 70/155 45%, Positives = 104/155 67%, Gaps = 13/155 8%
Query  7    GDSFPSDVVFSYIPWSE--DKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSAR 64
            G+  P D +  YIPW+   D GE+  CGIP  +    EW  KKV++ ++PGA+TP+C  +
Sbjct  11   GNEIP-DTLMGYIPWTPELDSGEV--CGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQ 67
Query  65   HVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIG 124
            H+P  ++++ E++AKGVD V V+A ND +VM+AWG  N    D ++F +D D  FSK++G
Sbjct  68   HIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAK-DKVVFATDIDLAFSKALG 126
Query  125  W-----ADEEG-RTKRYALVIDHGKIT-YAALEPAKNHLEFSSAETVL 165
                  A   G RT RYAL+ID  KI  +A+ E     L+ +S +T+L
Sbjct  127  ATIDLSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTIL 174

Sequence Alignment: 4. Allergen Name: Mala s 5 Sequence ID: CAA09883

 Score = 104.6 bits 428,  Expect = 2e-24
 Identities = 74/157 47%, Positives = 103/157 65%, Gaps = 15/157 9%
Query  7    GDSFPSDVVFSYIPWSE--DKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSAR 64
            G   P +  F+YIPW+   D G++  CG+P  + A   W  KKV++ A+PGAFTP C   
Sbjct  6    GSQAP-NTTFTYIPWAPELDSGKV--CGVPQTFKAHDRWKGKKVVVVAIPGAFTPACHQN 62
Query  65   HVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTG-DDILFLSDPDARFSKSI 123
            H+P ++EK+ E++AKGVD V V+A NDA+VMS WG    V G D I++  D D  FSK++
Sbjct  63   HIPGFVEKINELKAKGVDEVVVIAVNDAFVMSGWGVT--VGGKDQIVYACDNDLAFSKAL 120
Query  124  GWADE--EG----RTKRYALVIDHGKITYAALEPAKNHL-EFSSAETVLKHL 168
            G   +   G    RT RYA+V+D  KITY  ++       E SS + VL +L
Sbjct  121  GGTLDLTSGGMGVRTARYAVVLDDLKITYFGMDEGNMGAPEKSSVDAVLAQL 172

Sequence Alignment: 5. Allergen Name: Mala f 3 Sequence ID: P56578

 Score = 100.1 bits 408,  Expect = 3e-23
 Identities = 64/158 40%, Positives = 100/158 63%, Gaps = 10/158 6%
Query  7    GDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHV 66
            G + P +  F+Y+P+S +  +   CG+P ++ + + W  KKV++ A+PGAFTP C+A HV
Sbjct  3    GSTIP-NATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHV 61
Query  67   PEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWA 126
            P Y+EK+ E+++KGVD V V++ ND +V+SAWG   +   D++ F  D +  FSK     
Sbjct  62   PPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAK-DNLTFAQDVNCEFSKHFNAT 120
Query  127  ---DEEG---RTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL 168
                 +G   RT RYAL+ +  K+ Y  ++  +     SSA TVL  L
Sbjct  121  LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEPKQ--SSAATVLSKL 166

Sequence Alignment: 6. Allergen Name: Cand b 2 Sequence ID: AAA34358

 Score = 81.4 bits 326,  Expect = 1e-17
 Identities = 61/158 38%, Positives = 100/158 63%, Gaps = 19/158 12%
Query  1    MSGLKAGDSFPS-DVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTP 59
            M+ +K GD FP+ D V+ YIP   + GE      P  +  SK    KK ++ ++PGAFTP
Sbjct  1    MAPIKRGDRFPTTDDVY-YIP--PEGGE------PGAFELSKFVKTKKFVVVSVPGAFTP 51
Query  60   VCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKA-NQVTGDDILFLSDPDAR 118
             C+ +H+P YI+ LP I +KGVD V V+  ND +V+  W K         ++F+SDP+ +
Sbjct  52   PCTEQHLPGYIKNLPRILSKGVDFVLVITQNDPFVLKGWKKELGAADAKKLIFVSDPNLK 111
Query  119  FSKSIGWADEEG------RTKRYALVIDH-GKITYAALEPAKNHLEFSSAETVLKHL 168
            ++K +G   +        R+ R AL+++  G + YAA+E     ++ S+A+ ++  L
Sbjct  112  LTKKLGSTIDLSSIGLGTRSGRLALIVNRSGIVEYAAIENG-GEVDVSTAQKIIAKL 167

Sequence Alignment: 7. Allergen Name: Cand b 2 Sequence ID: AAA34357

 Score = 80.0 bits 320,  Expect = 4e-17
 Identities = 61/158 38%, Positives = 100/158 63%, Gaps = 19/158 12%
Query  1    MSGLKAGDSFPS-DVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTP 59
            M+ +K GD FP+ D V+ YIP   + GE      P     SK    KK ++ ++PGAFTP
Sbjct  1    MAPIKRGDRFPTTDDVY-YIP--PEGGE------PGPLELSKFVKTKKFVVVSVPGAFTP 51
Query  60   VCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKA-NQVTGDDILFLSDPDAR 118
             C+ +H+P YI+ LP I +KGVD V V++ ND +V+  W K         ++F+SDP+ +
Sbjct  52   PCTEQHLPGYIKNLPRILSKGVDFVLVISQNDPFVLKGWKKELGAADAKKLVFVSDPNLK 111
Query  119  FSKSIGWADEEG------RTKRYALVIDH-GKITYAALEPAKNHLEFSSAETVLKHL 168
            ++K +G   +        R+ R AL+++  G + YAA+E     ++ S+A+ ++  L
Sbjct  112  LTKKLGSTIDLSAIGLGTRSGRLALIVNRSGIVEYAAIENG-GEVDVSTAQKIIAKL 167

Sequence Alignment: 8. Allergen Name: Tri a 32.0101 Sequence ID: AAQ74769

 Score = 33.4 bits 116,  Expect = 0.005
 Identities = 23/80 28%, Positives = 39/80 48%, Gaps = 6/80 7%
Query  48   VILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQV--T 105
            VILF+ PG FTPVC+   +        E   +GV ++ + + +D      W K  +    
Sbjct  33   VILFSHPGDFTPVCTTE-LAAMANYAKEFEKRGVKLLGI-SCDDVQSHKEWTKDIEAYKP 90
Query  106  GDDILF--LSDPDARFSKSIGWADEE 129
            G  + +  ++DPD    K +   D +
Sbjct  91   GSKVTYPIMADPDRSAIKQLNMVDPD 116

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.