The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSIHIKDVEDLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV
DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTILKLK
Sequence Info Allergen Name Length Opt Bits Score E Value
CBW45298 Plo i 2.0101 106 685 196.6 1.2e-52
CAI78451 Mala s 13.0101 105 301 89.9 1.6e-20
Q9UW02 Cop c 2 106 277 83.2 1.6e-18
Q9LDX4 Tri a 25.0101 125 269 81.0 9.2e-18
AJ937744 Asp f 28.0101 108 260 78.5 4.4e-17
Q4W1F7 Zea m 25.0101 128 257 77.6 9.6e-17
AJ937745 Asp f 29.0101 110 232 70.7 9.8e-15
AAL79931 Fus c 2 121 221 67.6 9.2e-14
CAA58999 Alt a 4 433 132 42.5 1.2e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Plo i 2.0101 Sequence ID: CBW45298

 Score = 196.6 bits 685,  Expect = 1e-52
 Identities = 106/106 100%, Positives = 106/106 100%, Gaps = 0/106 0%
Query  1    MSIHIKDVEDLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV 60
            MSIHIKDVEDLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV
Sbjct  1    MSIHIKDVEDLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV 60
Query  61   DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTILKLK 106
            DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTILKLK
Sbjct  61   DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTILKLK 106

Sequence Alignment: 2. Allergen Name: Mala s 13.0101 Sequence ID: CAI78451

 Score = 89.9 bits 301,  Expect = 2e-20
 Identities = 46/86 53%, Positives = 60/86 69%, Gaps = 1/86 1%
Query  19   GDKLVVIDFMATWCGPCKIIGPKLDEIAAEMA-DSIVVVKVDVDECEDIATEYSINTMPT 77
            GDK+VVIDF ATWCGPCK+IGP +++I+   A D +   KVDVDE   IA E  I  MPT
Sbjct  16   GDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDEQSQIAQEVGIRAMPT 75
Query  78   FVFVKNGKPVEQFSGANVEKLRSTILK 104
            FVF KNG+ ++   GA+  KL++ I +
Sbjct  76   FVFFKNGQKIDTVVGADPSKLQAAITQ 102

Sequence Alignment: 3. Allergen Name: Cop c 2 Sequence ID: Q9UW02

 Score = 83.2 bits 277,  Expect = 2e-18
 Identities = 41/94 43%, Positives = 63/94 67%, Gaps = 2/94 2%
Query  10   DLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEM-ADSIVVVKVDVDECEDIAT 68
            D   +LT +G K+++IDF ATWCGPC++I P +++ + +  A++IV  KVDVD   DI+ 
Sbjct  9    DEFNKLTNSG-KIIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKVDVDTASDISE 67
Query  69   EYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTILK 104
            E  I  MPTF   K+G+ ++++ GAN   L S + K
Sbjct  68   EAKIRAMPTFQVYKDGQKIDELVGANPTALESLVQK 103

Sequence Alignment: 4. Allergen Name: Tri a 25.0101 Sequence ID: Q9LDX4

 Score = 81.0 bits 269,  Expect = 9e-18
 Identities = 42/99 42%, Positives = 66/99 66%, Gaps = 3/99 3%
Query  3    IHIKDVEDLTARLTEAG--DKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV 60
            I +  +E  T ++ EA    KLVVIDF A+WCGPC+I+ P + ++A +   + V +KVDV
Sbjct  19   ISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFP-AAVFLKVDV 77
Query  61   DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTI 102
            DE + IA ++S+  MPTF+F+K G   ++  GA  E+L + +
Sbjct  78   DELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKV 119

Sequence Alignment: 5. Allergen Name: Asp f 28.0101 Sequence ID: AJ937744

 Score = 78.5 bits 260,  Expect = 4e-17
 Identities = 39/85 45%, Positives = 59/85 69%, Gaps = 4/85 4%
Query  15   LTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDVDECEDIATEYSINT 74
            LT +G   VV+DF ATWCGPC+ + PK+ E++ E   ++  ++VDVD+   +A E +I  
Sbjct  18   LTSSGP--VVVDFFATWCGPCRAVAPKVGELS-EKYSNVRFIQVDVDKVRSVAHEMNIRA 74
Query  75   MPTFVFVKNGKPVEQ-FSGANVEKLRSTI 102
            MPTFV+ K+G+P+E+   G NV +L   I
Sbjct  75   MPTFVLYKDGQPLEKRVVGGNVRELEEMI 103

Sequence Alignment: 6. Allergen Name: Zea m 25.0101 Sequence ID: Q4W1F7

 Score = 77.6 bits 257,  Expect = 1e-16
 Identities = 40/95 42%, Positives = 65/95 68%, Gaps = 3/95 3%
Query  3    IHIKDVEDLTARLTEAGD--KLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV 60
            I I  +E+ + ++ EA    KLVVIDF ATWC PC+ + P + ++A + + ++V +KVDV
Sbjct  22   IAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKK-SPNVVFLKVDV 80
Query  61   DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKL 98
            DE + IA ++S+  MPTF+F++ G   ++  GA  E+L
Sbjct  81   DEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEEL 118

Sequence Alignment: 7. Allergen Name: Asp f 29.0101 Sequence ID: AJ937745

 Score = 70.7 bits 232,  Expect = 1e-14
 Identities = 36/102 35%, Positives = 59/102 57%, Gaps = 3/102 2%
Query  1    MSIHIKDVED--LTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIA-AEMADSIVVVK 57
            MS +++ + D  +     + G   V++D  ATWCGPCK I P +  ++ +E   +    +
Sbjct  1    MSHNVEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYE 60
Query  58   VDVDECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTI 102
            +DVDE  ++A E  +  MPTF+F K+G+ V +  GAN   L + I
Sbjct  61   IDVDELSEVAAELGVRAMPTFMFFKDGQKVNEVVGANPPALEAAI 105

Sequence Alignment: 8. Allergen Name: Fus c 2 Sequence ID: AAL79931

 Score = 67.6 bits 221,  Expect = 9e-14
 Identities = 35/85 41%, Positives = 50/85 58%, Gaps = 4/85 4%
Query  1    MSIHIKDVEDLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMA--DSIVVVKV 58
            M  HI   ++L   L+      VV+DF A WC PCK I P  ++++ + +  D +   KV
Sbjct  1    MVHHITSNDELQKLLSST--TYVVVDFFADWCPPCKAIAPVYEQLSTKHSVPDVLAFAKV 58
Query  59   DVDECEDIATEYSINTMPTFVFVKNGKPV 87
            +VD  +D A +Y I  MPTF+F K GK V
Sbjct  59   NVDHVQDAAQQYGITAMPTFMFFKEGKQV 87

Sequence Alignment: 9. Allergen Name: Alt a 4 Sequence ID: CAA58999

 Score = 42.5 bits 132,  Expect = 1e-05
 Identities = 21/59 35%, Positives = 35/59 59%, Gaps = 7/59 11%
Query  20   DKLVVIDFMATWCGPCKIIGPKLDEIAA-----EMADSIVVVKVDVDECEDIATEYSINT 74
            DK V+++F A WCG CK + PK +E+       E++  + + KVD     D+  E     
Sbjct  251  DKDVLVEFYAPWCGHCKALAPKYEELGQLYASDELSKLVTIAKVDAT-LNDVPDEIQ-GF 308
Query  75   MPTFVF 80
            +P+ +F
Sbjct  309  LPSSLF 314

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.