The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK
GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK
AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE
AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI
IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD
WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA
QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK
AKFAGKDYRHPKIN
Sequence Info Allergen Name Length Opt Bits Score E Value
B5DGQ7 Sal s 2.0101 434 2855 657.1 4.8e-190
A0A2U9IY94 Cyp c 2.0101 433 2696 620.9 3.9e-179
XP_034156632 Pan h 2.0101 434 2629 605.6 1.5e-174
P07322 Gal d 9.0101 434 2371 546.8 7.8e-157
Q9LEI9 Hev b 9 445 1912 442.1 2.5e-125
Q9LEJ0 Hev b 9 445 1910 441.7 3.4e-125
A0A1B2H9Q5 Amb a 12.0102 445 1901 439.6 1.4e-124
Q870B9 Rho m 1.0101 439 1819 421.0 5.9e-119
A0A1B2H9Q1 Amb a 12.0101 431 1810 418.9 2.4e-118
AAK49451 Asp f 22.0101 438 1801 416.8 1e-117
Q9HDT3 Alt a 5 438 1776 411.2 5.3e-116
AAK51201 Pen c 22.0101 438 1773 410.5 8.5e-116
P42040 Cla h 6 440 1768 409.3 1.9e-115
CAA55070 Cla h 6 440 1742 403.4 1.1e-113
AAK67491 Cur l 2.0101 440 1679 389.0 2.4e-109
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal s 2.0101 Sequence ID: B5DGQ7

 Score = 657.1 bits 2855,  Expect = 5e-190
 Identities = 434/434 100%, Positives = 434/434 100%, Gaps = 0/434 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK
Sbjct  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK
Sbjct  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
Query  121  AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE 180
            AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE
Sbjct  121  AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE 180
Query  181  AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI 240
            AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI
Sbjct  181  AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI 240
Query  241  IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD 300
            IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD
Sbjct  241  IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD 300
Query  301  WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA 360
            WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA
Sbjct  301  WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA 360
Query  361  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK 420
            QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK
Sbjct  361  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK 420
Query  421  AKFAGKDYRHPKIN 434
            AKFAGKDYRHPKIN
Sbjct  421  AKFAGKDYRHPKIN 434

Sequence Alignment: 2. Allergen Name: Cyp c 2.0101 Sequence ID: A0A2U9IY94

 Score = 620.9 bits 2696,  Expect = 4e-179
 Identities = 406/433 93%, Positives = 420/433 96%, Gaps = 0/433 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            MSI+KIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDK+RYLGK
Sbjct  1    MSISKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKTRYLGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            GT KAVDHVNK+IA KLIEKKFSVV+QEKID FMLELDGTENKSKFGANAILGVSLAVCK
Sbjct  61   GTQKAVDHVNKEIAPKLIEKKFSVVEQEKIDKFMLELDGTENKSKFGANAILGVSLAVCK 120
Query  121  AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE 180
            AGAAEKGVPLYRHIADLAG+KDVILP PAFNVINGGSHAGNKLAMQEFMILP+GA NFHE
Sbjct  121  AGAAEKGVPLYRHIADLAGNKDVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAKNFHE 180
Query  181  AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI 240
            AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLK+AIEKAGYPDKI
Sbjct  181  AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYPDKI 240
Query  241  IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD 300
            IIGMDVAASEF+K GKYDLDFKSPDDP R+ITGDQLGDLYKSFIK YPVQSIEDPFDQDD
Sbjct  241  IIGMDVAASEFFKNGKYDLDFKSPDDPKRHITGDQLGDLYKSFIKNYPVQSIEDPFDQDD 300
Query  301  WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA 360
            W  W+KFT +VDIQVVGDDLTVTNPKRIQQA EKKACNCLLLKVNQIGSVTESI+ACKLA
Sbjct  301  WENWSKFTGSVDIQVVGDDLTVTNPKRIQQACEKKACNCLLLKVNQIGSVTESIQACKLA 360
Query  361  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK 420
            QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELG K
Sbjct  361  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDK 420
Query  421  AKFAGKDYRHPKI 433
            AKFAGKD+RHPK+
Sbjct  421  AKFAGKDFRHPKL 433

Sequence Alignment: 3. Allergen Name: Pan h 2.0101 Sequence ID: XP_034156632

 Score = 605.6 bits 2629,  Expect = 2e-174
 Identities = 393/434 90%, Positives = 413/434 95%, Gaps = 0/434 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            MSI KIHAREILDSRGNPTVEVDLYT KGRFRAAVPSGASTGVHEALELRDGDK+R+LGK
Sbjct  1    MSIVKIHAREILDSRGNPTVEVDLYTEKGRFRAAVPSGASTGVHEALELRDGDKTRFLGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G  KAVDHVNKDIA KL+EKK+SVVDQEKID +MLELD TENKSKFGANAILGVSLAVCK
Sbjct  61   GVTKAVDHVNKDIAPKLLEKKLSVVDQEKIDKLMLELDATENKSKFGANAILGVSLAVCK 120
Query  121  AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE 180
            AGAAEKGVPL+RHIADLAGH DVILP PAFNVINGGSHAGNKLAMQEFMILP+GA+NF E
Sbjct  121  AGAAEKGVPLFRHIADLAGHADVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE 180
Query  181  AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI 240
            AMRIGAEVYHNLK VIK KYGKDATNVGDEGGFAPNILENNEALELLK+AIEKAGY DKI
Sbjct  181  AMRIGAEVYHNLKGVIKGKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYADKI 240
Query  241  IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD 300
            +IGMDVAASEFY++GKYDLDFKSPDDP R+ITGDQL DLYKSFIK YPV SIEDPFDQDD
Sbjct  241  VIGMDVAASEFYRSGKYDLDFKSPDDPKRHITGDQLADLYKSFIKNYPVLSIEDPFDQDD 300
Query  301  WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA 360
            W  WTKFT++VDIQ+VGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESI+ACKLA
Sbjct  301  WENWTKFTSSVDIQIVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIQACKLA 360
Query  361  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK 420
            Q NGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE+LG K
Sbjct  361  QKNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEQLGDK 420
Query  421  AKFAGKDYRHPKIN 434
            AKFAGKD+RHPK+N
Sbjct  421  AKFAGKDFRHPKVN 434

Sequence Alignment: 4. Allergen Name: Gal d 9.0101 Sequence ID: P07322

 Score = 546.8 bits 2371,  Expect = 8e-157
 Identities = 352/432 81%, Positives = 390/432 90%, Gaps = 0/432 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            MSI KIHAREILDSRG PTVEVDL+TAKG FRAAVPSGASTG+HEALE RDGDK R+LGK
Sbjct  1    MSIQKIHAREILDSRGEPTVEVDLHTAKGHFRAAVPSGASTGIHEALEPRDGDKKRFLGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G +KAV+H+NK I   LIEKK SVV+QEKID  M+E+DGTENKSKFGANAILGVSLAVCK
Sbjct  61   GVLKAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCK 120
Query  121  AGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHE 180
            AGAAEKGVPLYRHIADLAG+ ++ILP PAFNVINGGSHAGNKLAMQEFM+LP+GA++FH+
Sbjct  121  AGAAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASFHD 180
Query  181  AMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKI 240
            AMR+GAEVYH+LK VIKAKYGKDATNVG EGGFAPNIL+N+EALELLK AI +AGY DK+
Sbjct  181  AMRVGAEVYHSLKGVIKAKYGKDATNVGGEGGFAPNILDNHEALELLKAAIAQAGYTDKV 240
Query  241  IIGMDVAASEFYKAGKYDLDFKSPDDPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDD 300
            +IGMDVAASEF + G+Y LDFKSP    RYITG+QLG++Y+ FIK YPV SIEDPFDQDD
Sbjct  241  VIGMDVAASEFCRDGRYHLDFKSPPHTKRYITGEQLGEIYRGFIKDYPVVSIEDPFDQDD 300
Query  301  WAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLA 360
            W AW +F   VDIQVVGDDLTVTNPKRI +  E+ ACNCLLLKVNQIGSVTESI+ACKLA
Sbjct  301  WEAWKRFVFHVDIQVVGDDLTVTNPKRIAHGAEQHACNCLLLKVNQIGSVTESIQACKLA 360
Query  361  QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAK 420
            QS+GWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE LG K
Sbjct  361  QSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK 420
Query  421  AKFAGKDYRHPK 432
            AKFAG+ +R+PK
Sbjct  421  AKFAGRKFRNPK 432

Sequence Alignment: 5. Allergen Name: Hev b 9 Sequence ID: Q9LEI9

 Score = 442.1 bits 1912,  Expect = 3e-125
 Identities = 300/428 70%, Positives = 364/428 85%, Gaps = 14/428 3%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKSRYLG 59
            ++I  + AR+I+DSRGNPTVE D+  + G + RAAVP GASTG++EALELRDG  S YLG
Sbjct  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
Query  60   KGTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLE-LDGTEN-----KSKFGANAILG 113
            KG  KAV++VN  I   L+ K  +  DQ  ID+FM++ LDGT N     K K+GANAIL 
Sbjct  62   KGVSKAVENVNIIIGPALVGKDPT--DQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
Query  114  VSLAVCKAGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPI 173
            VSLAVCKAGA  KG+PLY+H+A+LAG+K+++LP PAFNVINGGSHAGNKLAMQEFMILP+
Sbjct  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPV 179
Query  174  GASNFHEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEK 233
            GAS+F EAM++GAEVYH+LK+VIK KYG+DATNVGDEGGFAPNI EN E LELLKTAI K
Sbjct  180  GASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 239
Query  234  AGYPDKIIIGMDVAASEFYKAGK-YDLDFKSPDDP-ARYITGDQLGDLYKSFIKGYPVQS 291
            AGY  K++IGMDVAASEFY + K YDL+FK  ++  ++ I+GD L DLYKSF+  YP+ S
Sbjct  240  AGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVS 299
Query  292  IEDPFDQDDWAAWTKFTA--AVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGS 349
            IEDPFDQDDW  + K+T+   V +Q+VGDDL VTNPKR+++A+++KACN LLLKVNQIGS
Sbjct  300  IEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGS 359
Query  350  VTESIKACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
            VTESI+A K+++  GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  360  VTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
Query  410  LMRIEEELGAKAKFAGKDYRHP 431
            L+RIEEELGA+A +AG ++R P
Sbjct  420  LLRIEEELGAEAVYAGANFRTP 441

Sequence Alignment: 6. Allergen Name: Hev b 9 Sequence ID: Q9LEJ0

 Score = 441.7 bits 1910,  Expect = 3e-125
 Identities = 299/428 69%, Positives = 365/428 85%, Gaps = 14/428 3%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKSRYLG 59
            ++I  + AR+I+DSRGNPTVE D+  + G + RAAVPSGASTG++EALELRDG  S YLG
Sbjct  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGG-SDYLG 61
Query  60   KGTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLE-LDGTEN-----KSKFGANAILG 113
            KG  KAV++VN  I   L+ K  +  DQ  ID+FM++ LDGT N     K K+GANAIL 
Sbjct  62   KGVSKAVENVNIIIGPALVGKDPT--DQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
Query  114  VSLAVCKAGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPI 173
            VSLAVCKAGA  KG+PLY HIA+LAG+K+++LP PAFNVINGGSHAGNKLAMQEFMILP+
Sbjct  120  VSLAVCKAGAHVKGIPLYEHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPV 179
Query  174  GASNFHEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEK 233
            GAS+F EAM++GAEVYH+LK+VIK KYG+DATNVGDEGGFAPNI EN E LELLKTAI K
Sbjct  180  GASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 239
Query  234  AGYPDKIIIGMDVAASEFYKAGK-YDLDFKSPDDP-ARYITGDQLGDLYKSFIKGYPVQS 291
            AGY  K++IGMDVAASEFY + + YDL+FK  ++  ++ I+G+ L DLYKSF+  YP+ S
Sbjct  240  AGYTGKVVIGMDVAASEFYGSDQTYDLNFKEENNNGSQKISGEALKDLYKSFVAEYPIVS 299
Query  292  IEDPFDQDDWAAWTKFTAAVD--IQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGS 349
            IEDPFDQDDWA + K+T+ +   +Q+VGDDL VTNPKR+++A+++KACN LLLKVNQIGS
Sbjct  300  IEDPFDQDDWAHYAKLTSEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGS 359
Query  350  VTESIKACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
            VTESI+A K+++  GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  360  VTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
Query  410  LMRIEEELGAKAKFAGKDYRHP 431
            L+RIEEELG++A +AG ++R P
Sbjct  420  LLRIEEELGSEAVYAGANFRKP 441

Sequence Alignment: 7. Allergen Name: Amb a 12.0102 Sequence ID: A0A1B2H9Q5

 Score = 439.6 bits 1901,  Expect = 1e-124
 Identities = 300/427 70%, Positives = 357/427 83%, Gaps = 15/427 3%
Query  2    SITKIHAREILDSRGNPTVEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKSRYLGK 60
            +I  + AR+I+DSRGNPTVEVD+  + G + RAAVPSGASTG++EALELRDG  S YLGK
Sbjct  3    TIKAVKARQIFDSRGNPTVEVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGK 61
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLE-LDGTEN-----KSKFGANAILGV 114
            G  KAV +VN  I   L+ K  +  DQ  ID+FM++ LDGT+N     K K+GANAIL V
Sbjct  62   GVSKAVANVNTIIGPALVGKDPT--DQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAV 119
Query  115  SLAVCKAGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIG 174
            SLAVCKAGA+    PLY+HIA+LAG+K+++LP PAFNVINGGSHAGNKLAMQEFMILPIG
Sbjct  120  SLAVCKAGASVLKTPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIG 179
Query  175  ASNFHEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKA 234
            AS+F EAM++G EVYHNLK+VIK KYG+DATNVGDEGGFAPNI EN E LELLKTAI KA
Sbjct  180  ASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA 239
Query  235  GYPDKIIIGMDVAASEFY--KAGKYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQS 291
            GY DK++IGMDVAASEFY  K   YDL+FK  + D    I+G+QL DLYKSF+  YP+ S
Sbjct  240  GYTDKVVIGMDVAASEFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVS 299
Query  292  IEDPFDQDDWAAWTKFTAAV--DIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGS 349
            IEDPFDQDDW  + K TA     +Q+VGDDL VTNP R+++A+++K CN LLLKVNQIGS
Sbjct  300  IEDPFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGS 359
Query  350  VTESIKACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
            VTESI+A ++++  GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  360  VTESIEAVRMSKHAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
Query  410  LMRIEEELGAKAKFAGKDYRHP 431
            L+RIEEELG++A +AG ++R P
Sbjct  420  LLRIEEELGSEAVYAGANFRKP 441

Sequence Alignment: 8. Allergen Name: Rho m 1.0101 Sequence ID: Q870B9

 Score = 421.0 bits 1819,  Expect = 6e-119
 Identities = 280/428 65%, Positives = 346/428 80%, Gaps = 5/428 1%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M+I+KIH+R + DSRGNPTVEV+L T KG FR+ VPSGASTGVHEALELRDGDKS++LGK
Sbjct  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G +KAV +VN  IA  LIE    V DQ KID F+L+LDGT NK+K+GANAILGVSLA  K
Sbjct  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
Query  121  AGAAEKGVPLYRHIADLAGHKD--VILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNF 178
            AGAA+K VPLY+HIAD++  K+   +LP P  NV+NGGSHAG  LA QEFMI+P GA +F
Sbjct  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
Query  179  HEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPD 238
             E +RIG+EVYH+LK++ K KYG+ A NVGDEGG AP+I    EAL+L+ +AIE AGY  
Sbjct  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
Query  239  KIIIGMDVAASEFYKAGKYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPFD 297
            ++ I MDVA+SEFYK G YDLDFK+P+ D +++ITG QL +LY+ ++  YP+ SIEDPF 
Sbjct  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
Query  298  QDDWAAWTKFTAAVD--IQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIK 355
            +DDW AW+ F + V+   Q+VGDDLTVTNP RI++A+E KA + LLLKVNQIG++TESI+
Sbjct  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
Query  356  ACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE 415
            A   + + GWGVMVSHRSGETEDTFIADL VG+ +GQ KTGAP RSERLAK NQ++RIEE
Sbjct  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
Query  416  ELGAKAKFAGKDY 428
            ELG KA +AGKD+
Sbjct  421  ELGDKAIYAGKDF 433

Sequence Alignment: 9. Allergen Name: Amb a 12.0101 Sequence ID: A0A1B2H9Q1

 Score = 418.9 bits 1810,  Expect = 2e-118
 Identities = 286/409 69%, Positives = 341/409 83%, Gaps = 15/409 3%
Query  20   VEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKSRYLGKGTVKAVDHVNKDIAAKLI 78
            ++VD+  + G + RAAVPSGASTG++EALELRDG  S YLGKG  KAV +VN  I   L+
Sbjct  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
Query  79   EKKFSVVDQEKIDHFMLE-LDGTEN-----KSKFGANAILGVSLAVCKAGAAEKGVPLYR 132
             K  +  DQ  ID+FM++ LDGT+N     K K+GANAIL V LAVCKAGA+    PLY+
Sbjct  66   GKDPT--DQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
Query  133  HIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFHEAMRIGAEVYHNL 192
            HIA+LAG+K+++LP PAFNVINGGSHAGNKLAMQEFMILPIGAS+F EAM++G EVYHNL
Sbjct  124  HIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNL 183
Query  193  KNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKIIIGMDVAASEFY 252
            K+VIK KYG+DATNVGDEGGFAPNI EN E LELLKTAI KAGY DK++IGMDVAASEFY
Sbjct  184  KSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFY 243
Query  253  --KAGKYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPFDQDDWAAWTKFTA 309
              K   YDL+FK  + D    I+G+QL DLYKSF+  YP+ SIEDPFDQDDW  + K TA
Sbjct  244  GEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTA 303
Query  310  AV--DIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKACKLAQSNGWGV 367
                 +Q+VGDDL VTNP R+++A+++K CN LLLKVNQIGSVTESI+A ++++  GWGV
Sbjct  304  ECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGV 363
Query  368  MVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGAKAKFAGKD 427
            M SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQL+RIEEELG++A +AG +
Sbjct  364  MASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAN 423
Query  428  YRHP 431
            +R P
Sbjct  424  FRKP 427

Sequence Alignment: 10. Allergen Name: Asp f 22.0101 Sequence ID: AAK49451

 Score = 416.8 bits 1801,  Expect = 1e-117
 Identities = 279/429 65%, Positives = 337/429 78%, Gaps = 4/429 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M I+KIHAR + DSRGNPTVEVD+ T  G  RA VPSGASTG HEA ELRDGDK+++ GK
Sbjct  1    MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELRDGDKTQWGGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G +KAV +VN+ I   LI++   V DQ K+D F+ +LDGT NKS +GANAILGVSLAV K
Sbjct  61   GVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGTANKSNLGANAILGVSLAVAK 120
Query  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
            AGAAEKGVPLY HI+DLAG  K  +LP P  NV+NGGSHAG +LA QEFMI+P  A +F 
Sbjct  121  AGAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFS 180
Query  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDK 239
            EA+R GAEVY+ LK + K KYG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  K
Sbjct  181  EALRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGK 240
Query  240  IIIGMDVAASEFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF 296
            I I MDVA+SEFYKA   KYDLDFK+P+ DP++++T +QL DLYKS+   YP+ SIEDPF
Sbjct  241  IKIAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF 300
Query  297  DQDDWAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKA 356
             +DDW AW+ F    D Q+VGDDLTVTNP RI++A+E K+CN LLLKVNQIG++TESI+A
Sbjct  301  AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQIGTLTESIQA 360
Query  357  CKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEE 416
             K + ++ WGVMVSHRSGETED  IAD+ VGL +GQIKTGAPCRSERLAK NQ++RIEEE
Sbjct  361  AKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPCRSERLAKLNQILRIEEE 420
Query  417  LGAKAKFAGKDYR 429
            LG    +AG  +R
Sbjct  421  LGENTVYAGSKFR 433

Sequence Alignment: 11. Allergen Name: Alt a 5 Sequence ID: Q9HDT3

 Score = 411.2 bits 1776,  Expect = 5e-116
 Identities = 277/429 64%, Positives = 336/429 78%, Gaps = 4/429 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M+ITKIHAR + DSRGNPTVEVD+ T  G  RA VPSGASTG HEA ELRDGDKS++ GK
Sbjct  1    MTITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWGGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G  KAV +VN  IA  LI++K+ V DQ  +D F+ +LDGT NK+ +GANAILGVS+A+ K
Sbjct  61   GVTKAVANVNDTIAPALIKEKLDVKDQSAVDAFLNKLDGTTNKTNLGANAILGVSMAIAK 120
Query  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
            A AAEKGVPLY HI+DLAG  K  +LP P  NV+NGGSHAG +LA QEFMI+P  A  F 
Sbjct  121  AAAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPCEAPTFS 180
Query  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDK 239
            EAMR GAEVY+ LK + K  YG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  K
Sbjct  181  EAMRQGAEVYQKLKALAKKTYGQSAGNVGDEGGVAPDIQTAEEALDLITKAIEEAGYTGK 240
Query  240  IIIGMDVAASEFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF 296
            I I MDVA+SEFYKA   KYDLDFK+PD D ++++T +QL ++YKS+ + YP+ SIEDPF
Sbjct  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWLTYEQLAEMYKSLAEKYPIVSIEDPF 300
Query  297  DQDDWAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKA 356
             +DDW AW+ F    D Q+VGDDLTVTNP+ I++A+E K+CN LLLKVNQIG++TE+I+A
Sbjct  301  AEDDWEAWSYFFKTYDGQIVGDDLTVTNPEFIKKAIELKSCNALLLKVNQIGTITEAIQA 360
Query  357  CKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEE 416
             K A   GWGVMVSHRSGETED  IAD+VVGL +GQIKTGAP RSERLAK NQ++RIEEE
Sbjct  361  AKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTGAPARSERLAKLNQILRIEEE 420
Query  417  LGAKAKFAGKDYR 429
            LG  A +AG ++R
Sbjct  421  LGDNAVYAGNNFR 433

Sequence Alignment: 12. Allergen Name: Pen c 22.0101 Sequence ID: AAK51201

 Score = 410.5 bits 1773,  Expect = 8e-116
 Identities = 275/429 64%, Positives = 334/429 77%, Gaps = 4/429 0%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M I K+HAR +  SRGNPTVEVD+ T  G  RA VPSGASTG HEA+ELRDGDK+++ GK
Sbjct  1    MPIAKVHARSVYVSRGNPTVEVDVVTETGLHRAIVPSGASTGQHEAVELRDGDKAKWGGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G +KAV +VN+ I   LI++   V DQ K+D F+ +LDGT NK  +GANAILGVSLA+ K
Sbjct  61   GVLKAVKNVNETIGPALIKENIDVKDQAKVDEFLNKLDGTANKGNLGANAILGVSLAIAK 120
Query  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
            A AAEKGVPLY HI+DLAG  K  +LP P  NV+NGGSHAG +LA QEFMI+P  A +F 
Sbjct  121  AAAAEKGVPLYVHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDTAESFS 180
Query  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDK 239
            E +R GAEVY+ LK + K KYG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  K
Sbjct  181  EGLRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGK 240
Query  240  IIIGMDVAASEFYK--AGKYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF 296
            I I MDVA+SEFYK  A KYDLDFK+PD DP +++T +QL DLYKS+   YP+ SIEDPF
Sbjct  241  ISIAMDVASSEFYKTDAKKYDLDFKNPDSDPTKWLTYEQLADLYKSLAAKYPIVSIEDPF 300
Query  297  DQDDWAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIKA 356
             +DDW AW+ F    D Q+VGDDLTVTNP RI++A+E K+CN LLLKVNQIG++TESI+A
Sbjct  301  AEDDWEAWSYFYKTSDFQIVGDDLTVTNPLRIKKAIELKSCNALLLKVNQIGTLTESIQA 360
Query  357  CKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEE 416
             K + ++ WGVMVSHRSGETED  IAD+ VGL +GQIKTGAP RSERLAK NQ++RIEEE
Sbjct  361  AKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPARSERLAKLNQILRIEEE 420
Query  417  LGAKAKFAGKDYR 429
            LG  A +AGK++R
Sbjct  421  LGENAIYAGKNFR 433

Sequence Alignment: 13. Allergen Name: Cla h 6 Sequence ID: P42040

 Score = 409.3 bits 1768,  Expect = 2e-115
 Identities = 277/429 64%, Positives = 337/429 78%, Gaps = 6/429 1%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M I+KIH+R + DSRGNPTVEVD+ T  G  RA VPSGASTG HEA ELRDGDKS++ GK
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWAGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G  KAV +VN+ IA  LI++ + V DQ  +D F+ +LDGT NK+K GANAILGVS+AV K
Sbjct  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
Query  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
            A AAEK VPLY HI+DL+G  K  +LP P  NV+NGGSHAG +LA QEFMI+P GA +F 
Sbjct  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
Query  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDK 239
            EAMR GAEVY+ LK++ K +YG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  +
Sbjct  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
Query  240  IIIGMDVAASEFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF 296
            I I MDVA+SEFYKA   KYDLDFK+PD D +++IT +QL D YK +   YP+ SIEDPF
Sbjct  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYKQLAAKYPIVSIEDPF 300
Query  297  DQDDWAAWTKF--TAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESI 354
             +DDW AW+ F  T+  D Q+VGDDLTVTNP+ I++A+E KACN LLLKVNQIG++TE+I
Sbjct  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
Query  355  KACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
             A K + + GWGVMVSHRSGETED  IAD+VVGL  GQIKTGAP RSERLAK NQ++RIE
Sbjct  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
Query  415  EELGAKAKFAGKDYR 429
            EELG KA +AG ++R
Sbjct  421  EELGDKAVYAGDNFR 435

Sequence Alignment: 14. Allergen Name: Cla h 6 Sequence ID: CAA55070

 Score = 403.4 bits 1742,  Expect = 1e-113
 Identities = 274/429 63%, Positives = 334/429 77%, Gaps = 6/429 1%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M I+KIH+R + DSRGNPTVEVD+ T  G  RA VPS ASTG HEA ELRDGDKS++ GK
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G  KAV +VN+ IA  LI++ + V DQ  +D F+ +LDGT NK+K GANAILGVS+AV K
Sbjct  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
Query  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
            A AAEK VPLY HI+DL+G  K  +LP P  NV+NGGSHAG +LA QEFMI+P GA +F 
Sbjct  121  AAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSFT 180
Query  180  EAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDK 239
            EAMR GAEVY+ LK++ K +YG+ A NVGDEGG AP+I    EAL+L+  AIE+AGY  +
Sbjct  181  EAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQ 240
Query  240  IIIGMDVAASEFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF 296
            I I MDVA+SEFYKA   KYDLDFK+PD D +++IT +QL D Y  +   YP+ SIEDPF
Sbjct  241  IKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF 300
Query  297  DQDDWAAWTKF--TAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESI 354
             +DDW AW+ F  T+  D Q+VGDDLTVTNP+ I++A+E KACN LLLKVNQIG++TE+I
Sbjct  301  AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEAI 360
Query  355  KACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
             A K + + GWGVMVSHRSGETED  IAD+VVGL  GQIKTGAP RSERLAK NQ++RIE
Sbjct  361  NAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRIE 420
Query  415  EELGAKAKFAGKDYR 429
            EELG K  +AG ++R
Sbjct  421  EELGDKRLYAGDNFR 435

Sequence Alignment: 15. Allergen Name: Cur l 2.0101 Sequence ID: AAK67491

 Score = 389.0 bits 1679,  Expect = 2e-109
 Identities = 271/431 62%, Positives = 330/431 76%, Gaps = 9/431 2%
Query  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
            M+ITKIHAR + DSRGNPTVEVD+ T  G  RA VPSGASTG HEA ELRDGDK+++ GK
Sbjct  1    MAITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKTKWGGK 60
Query  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
            G  KAV +VN  IA  LI++K+ V DQ  +D F+ +LDGTENK+K+GANAILGVS+A+ K
Sbjct  61   GVTKAVANVNDIIAPALIKEKLDVKDQSAVDAFLNKLDGTENKTKLGANAILGVSMAIAK 120
Query  121  AGAAEKGVPLYRHIADLAG-HKDVILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNFH 179
            A AAEKGVPLY HI+DLAG  K  ++   + NV+NGGSHAG  L  QEFMI P  A  F 
Sbjct  121  AAAAEKGVPLYAHISDLAGTKKPYVFRFLSKNVLNGGSHAGGFLLFQEFMIAP--AKTFA 178
Query  180  EAMRI--GAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYP 237
            EA+RI  GAEVY+ LK + K  YG+ A N GDEGG AP+I    EAL+L+  AIE AG+ 
Sbjct  179  EALRIRQGAEVYQKLKALTKKTYGQSAGNYGDEGGVAPDIQTAEEALDLIVDAIEAAGHT 238
Query  238  DKIIIGMDVAASEFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIED 294
             +I I MDVA+SEF+K    KYDLDFK+PD D ++++T  QL ++YKS+ + YP+ SIED
Sbjct  239  GQIKIAMDVASSEFFKDDEKKYDLDFKNPDSDKSKWLTYPQLAEMYKSLAEKYPIVSIED 298
Query  295  PFDQDDWAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESI 354
            PF +DDW AW+ F    D Q+VGDDLTVTNP+ I+ A+E K+CN LLLKVNQIG+++E+I
Sbjct  299  PFAEDDWEAWSHFYKDGDFQIVGDDLTVTNPEFIKTAIELKSCNALLLKVNQIGTISEAI 358
Query  355  KACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIE 414
             A K A   GWGVMVSHRSGETED  IAD+VVGL +GQIKT AP RSERLAKYNQ++RIE
Sbjct  359  NAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTNAPARSERLAKYNQILRIE 418
Query  415  EELGAKAKFAGKDYRHPKIN 434
            EELG K  FAG  + H  IN
Sbjct  419  EELGDKRLFAGNKF-HTAIN 437

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.