The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA
MNPSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEIS
SMVLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAA
IAYGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVN
HFVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITR
ARFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFNKDPN
KSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTT
IPTRSPRLSLPTPTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGHFDV
DANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKN
GPESYAYSLRNTVNEGKLSISDSDKEKLRARLTRLSTGSTTTRPPARRSTTLNRRSSRVL
PTPSFWLPTVVLAVVVPPLVVTPVLVALVVLTRLRSALRSLTKKVFNGVFLFPVLFDVS
Sequence Info Allergen Name Length Opt Bits Score E Value
L7V065 Der f 28.0101 659 4168 956.2 0
P40918 Cla h 5.0101 643 2690 619.3 2.5e-178
AOD75395 Tyr p 28.0101 659 2602 599.3 2.9e-172
QAT18639 Der p 28.0101 655 2552 587.9 7.6e-169
AIO08848 Der f 28.0201 654 2538 584.7 7e-168
Q92260 Pen c 19 503 2175 502.0 4.2e-143
CAC14168 Cor a 10 668 2107 486.4 2.7e-138
Q1HR69 Aed a 8.0101 655 2082 480.7 1.4e-136
CAD20981 Mala s 10 773 799 188.2 1.8e-48
AAB48042 Alt a 3 124 339 84.5 5e-18
P78983 Alt a 3 152 339 84.2 7.6e-18
BAA04556 Der f mag29 145 160 43.4 1.3e-05
AAB48043 Alt a 3 117 134 37.8 0.00051
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 28.0101 Sequence ID: L7V065

 Score = 956.2 bits 4168,  Expect = 0
 Identities = 659/659 100%, Positives = 659/659 100%, Gaps = 0/659 0%
Query  1    MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA 60
            MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA
Sbjct  1    MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA 60
Query  61   MNPSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEIS 120
            MNPSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEIS
Sbjct  61   MNPSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEIS 120
Query  121  SMVLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAA 180
            SMVLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAA
Sbjct  121  SMVLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAA 180
Query  181  IAYGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVN 240
            IAYGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVN
Sbjct  181  IAYGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVN 240
Query  241  HFVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITR 300
            HFVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITR
Sbjct  241  HFVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITR 300
Query  301  ARFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFNKDPN 360
            ARFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFNKDPN
Sbjct  301  ARFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFNKDPN 360
Query  361  KSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTT 420
            KSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTT
Sbjct  361  KSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTT 420
Query  421  IPTRSPRLSLPTPTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGHFDV 480
            IPTRSPRLSLPTPTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGHFDV
Sbjct  421  IPTRSPRLSLPTPTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGHFDV 480
Query  481  DANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKN 540
            DANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKN
Sbjct  481  DANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKN 540
Query  541  GPESYAYSLRNTVNEGKLSISDSDKEKLRARLTRLSTGSTTTRPPARRSTTLNRRSSRVL 600
            GPESYAYSLRNTVNEGKLSISDSDKEKLRARLTRLSTGSTTTRPPARRSTTLNRRSSRVL
Sbjct  541  GPESYAYSLRNTVNEGKLSISDSDKEKLRARLTRLSTGSTTTRPPARRSTTLNRRSSRVL 600
Query  601  PTPSFWLPTVVLAVVVPPLVVTPVLVALVVLTRLRSALRSLTKKVFNGVFLFPVLFDVS 659
            PTPSFWLPTVVLAVVVPPLVVTPVLVALVVLTRLRSALRSLTKKVFNGVFLFPVLFDVS
Sbjct  601  PTPSFWLPTVVLAVVVPPLVVTPVLVALVVLTRLRSALRSLTKKVFNGVFLFPVLFDVS 659

Sequence Alignment: 2. Allergen Name: Cla h 5.0101 Sequence ID: P40918

 Score = 619.3 bits 2690,  Expect = 3e-178
 Identities = 439/565 77%, Positives = 486/565 86%, Gaps = 13/565 2%
Query  5    PAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPS 64
            PAIGIDLGTTYSCVG+++  ++EIIANDQGNRTTPS+V FTDTERLIGD+AKNQVA+NP 
Sbjct  3    PAIGIDLGTTYSCVGIYRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDSAKNQVAINPH 62
Query  65   NTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEISSMVL 124
            NTVFDAKRLIGRKF +  VQADMKH+PFKVIEK  KP  +VEFKGETK F PEEISSM+L
Sbjct  63   NTVFDAKRLIGRKFQDAEVQADMKHFPFKVIEKAGKPVTQVEFKGETKDFTPEEISSMIL 122
Query  125  VKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIAYG 184
             KMRETAE+YLGGTVNNAVITVPAYFNDSQRQATKD+GLIAGLNVLRIINEPTAAAIAYG
Sbjct  123  TKMRETAESYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYG 182
Query  185  LDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVK 244
            LDKK   GE+NVLIFDLGGGTFDVS+LTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHF  
Sbjct  183  LDKKQ-EGEKNVLIFDLGGGTFDVSFLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFSN 241
Query  245  EFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFE 304
            EFKRKHKKDL+ NARALRRLRT+CERAKRTLSS+AQTSIEIDSLFEGIDF+TS TRARFE
Sbjct  242  EFKRKHKKDLSDNARALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFFTSNTRARFE 301
Query  305  ELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN-KDPNKSI 363
            E+  DLFR  MEP ER LRD K DKSSV+EIVL GGSTRIPK+Q+LV+DFFN K+P KSI
Sbjct  302  EVGQDLFRGNMEPGERTLRDDKIDKSSVHEIVLGGGSTRIPKVQKLVSDFFNGKEPCKSI 361
Query  364  NPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTTIPT 423
            NPDEA+AYGAAVQA+ILSGDTSSKST EILLLDVAPLSLGIETAGGVMTALIKR+TTIPT
Sbjct  362  NPDEAVAYGAAVQAAILSGDTSSKSTKEILLLDVAPLSLGIETAGGVMTALIKRNTTIPT 421
Query  424  R-SPRLSLPTPTTS--LVSRFRSTRVSVLAPRTTTSLVSSS--SPVSPCSSWCSSDRGHF 478
            + S  +S  +      L+  F   R    A     +L+     S + P           F
Sbjct  422  KKSETFSTFSDNQPGVLIQVFEGER----ARTKDINLMGKFELSGIRPAPRGVPQIEVTF 477
Query  479  DVDANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHA 538
            D+DANGIMNV A+EKGTGKTNKI ITNDKGRLSKEEIERMLA+AEKYK EDEAEA RI+A
Sbjct  478  DLDANGIMNVSALEKGTGKTNKIVITNDKGRLSKEEIERMLADAEKYKEEDEAEAGRIQA 537
Query  539  KNGPESYAYSLRNTVNEGKL--SISDSDKEKLRARLTR 574
            KNG ESYAYSL+NTV++ K+   +S  DKE L   + +
Sbjct  538  KNGLESYAYSLKNTVSDPKVEEKLSAEDKETLTGAIDK 575

Sequence Alignment: 3. Allergen Name: Tyr p 28.0101 Sequence ID: AOD75395

 Score = 599.3 bits 2602,  Expect = 3e-172
 Identities = 416/561 74%, Positives = 478/561 85%, Gaps = 12/561 2%
Query  3    KTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN 62
            KTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVAMN
Sbjct  5    KTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN 64
Query  63   PSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEISSM 122
            P+NTVFDAKRLIGR+FD+ +VQADMKHW F V+    KP IEVEFKGE K+F PEEISSM
Sbjct  65   PTNTVFDAKRLIGRRFDDASVQADMKHWSFNVVNDDGKPKIEVEFKGEKKKFFPEEISSM 124
Query  123  VLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIA 182
            VL KM+ETAEAYLG TV +AVITVPAYFNDSQRQATKD+G+IAGLNVLRIINEPTAAAIA
Sbjct  125  VLTKMKETAEAYLGTTVTSAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA 184
Query  183  YGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHF 242
            YGLDKK   GE+NVLIFDLGGGTFDVS+LTIE+GIFEVKSTAGDTHLGGEDFDNRLVNHF
Sbjct  185  YGLDKKT-QGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRLVNHF 243
Query  243  VKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRAR 302
            V+EFKRKHKKD + N RALRRLRT+CERAKRTLSS+ Q SIEIDSL+EGIDFY+SITRAR
Sbjct  244  VQEFKRKHKKDPSDNKRALRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYSSITRAR 303
Query  303  FEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN-KDPNK 361
            FEELCADLFRST++PVE+ LRDAK DK+ ++EIVLVGGSTRIPKIQ+L+ DFFN K+ NK
Sbjct  304  FEELCADLFRSTLDPVEKSLRDAKLDKNQIHEIVLVGGSTRIPKIQKLLQDFFNGKELNK 363
Query  362  SINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTTI 421
            SINPDEA+AYGAAVQA+IL+GD SS+   +ILLLDVAPLSLGIETAGGVMTALIKR++TI
Sbjct  364  SINPDEAVAYGAAVQAAILNGDESSE-VQQILLLDVAPLSLGIETAGGVMTALIKRNSTI 422
Query  422  PTRSPRLSLPTPTTS----LVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGH 477
            PT+  + ++ T + +    L+  +   R           +  S  P  P           
Sbjct  423  PTKQTQ-TFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIP--PAPRGVPQIEVT 479
Query  478  FDVDANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIH 537
            FD+DANGI+NV AV+K TGK NKITITNDKGRLSKE+IERM+ EAE Y+ EDE +  RI 
Sbjct  480  FDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEDIERMVKEAESYRDEDEKQRDRIT 539
Query  538  AKNGPESYAYSLRNTVNEG--KLSISDSDKEKL 568
            A+N  ESYA+ +++++ E   K  IS+ D++K+
Sbjct  540  ARNTLESYAFQIKSSIEEEAIKSKISEEDRKKI 572

Sequence Alignment: 4. Allergen Name: Der p 28.0101 Sequence ID: QAT18639

 Score = 587.9 bits 2552,  Expect = 8e-169
 Identities = 405/559 72%, Positives = 478/559 85%, Gaps = 14/559 2%
Query  2    SKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAM 61
            SK PAIGIDLGTTYSCVGVFQ+G VEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVAM
Sbjct  6    SKAPAIGIDLGTTYSCVGVFQNGSVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 65
Query  62   NPSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEISS 121
            NP+NT+FDAKRLIGR+FDE +V++DMKHWPFKV+ +  KP IEVEFKGE K+F PEE+S+
Sbjct  66   NPANTIFDAKRLIGRRFDEPSVKSDMKHWPFKVVSESGKPKIEVEFKGEQKRFWPEEVSA 125
Query  122  MVLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAI 181
            MVL KM+ETAEAYLG  V +AVITVPAYFNDSQRQATKD+G+IAGLNVLRIINEPTAAAI
Sbjct  126  MVLTKMKETAEAYLGQKVTDAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAI 185
Query  182  AYGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNH 241
            AYGLDKKGG GE+NVLIFDLGGGTFDVS+LTI+ GIFEVKSTAGDTHLGGEDFDNRLVNH
Sbjct  186  AYGLDKKGG-GEKNVLIFDLGGGTFDVSVLTIDNGIFEVKSTAGDTHLGGEDFDNRLVNH 244
Query  242  FVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRA 301
            FV+EFKRK  KD+ +N RALRRLRT+CERAKRTLSS+ QT+IEIDSL EG DFY++ITRA
Sbjct  245  FVQEFKRKFGKDIMSNKRALRRLRTACERAKRTLSSSTQTTIEIDSLHEGTDFYSTITRA 304
Query  302  RFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN-KDPN 360
            RFEELC+DLFRST+EPVE+ LRDAK DKS ++EIVLVGGSTRIPKIQ+L++DFFN K+ N
Sbjct  305  RFEELCSDLFRSTLEPVEKALRDAKLDKSKIDEIVLVGGSTRIPKIQKLLSDFFNGKELN 364
Query  361  KSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTT 420
            KSINPDEA+AYGAAVQA+IL+GDTS+ +  ++LLLDVAPLSLGIETAGGVMT LIKR+TT
Sbjct  365  KSINPDEAVAYGAAVQAAILTGDTSN-NVKDLLLLDVAPLSLGIETAGGVMTTLIKRNTT 423
Query  421  IPTRSPRLSLPT-----PTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDR 475
            IPT+  + ++ T     P  + +  +   R          ++  +  P +P         
Sbjct  424  IPTKQTQ-TFTTYADNQPAVT-IQVYEGERAMTKDNNRLGTFDLTGIPPAPRG--VPQIE 479
Query  476  GHFDVDANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAAR 535
              FDVDANGI+NV AV+K TG+ NKITITNDKGRLSK +IE+M+ EAE+Y+ EDE +  R
Sbjct  480  VTFDVDANGILNVSAVDKSTGRQNKITITNDKGRLSKADIEKMVNEAEQYREEDERQRER 539
Query  536  IHAKNGPESYAYSLRNTVNEG--KLSISDSDKE 566
            I AKN  E+YA+ L++T+ E   K  +S+ D++
Sbjct  540  ISAKNQLEAYAFQLKSTMEEEAIKSKLSEEDRK 572

Sequence Alignment: 5. Allergen Name: Der f 28.0201 Sequence ID: AIO08848

 Score = 584.7 bits 2538,  Expect = 7e-168
 Identities = 402/558 72%, Positives = 476/558 85%, Gaps = 14/558 2%
Query  3    KTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN 62
            K PAIGIDLGTTYSCVGVFQ+G VEIIANDQGNRTTPSYV F DTERLIGDAAKNQV+MN
Sbjct  7    KAPAIGIDLGTTYSCVGVFQNGSVEIIANDQGNRTTPSYVAFNDTERLIGDAAKNQVSMN 66
Query  63   PSNTVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEISSM 122
            P+NT+FDAKRLIGR+FDE++V++DMKHWPFKV+ +  KP +EVEFKGE K+F PEEIS+M
Sbjct  67   PTNTIFDAKRLIGRRFDESSVKSDMKHWPFKVVSESGKPKLEVEFKGERKRFWPEEISAM 126
Query  123  VLVKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIA 182
            VL KM+ETAEAYLG  V + VITVPAYFNDSQRQATKD+G+IAGLNVLRIINEPTAAAIA
Sbjct  127  VLTKMKETAEAYLGQKVTDVVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIA 186
Query  183  YGLDKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHF 242
            YGLDKKGG GE+NVLIFDLGGGTFDVS+LTI+ GIFEVKSTAGDTHLGGEDFDNRLVNHF
Sbjct  187  YGLDKKGG-GEKNVLIFDLGGGTFDVSVLTIDNGIFEVKSTAGDTHLGGEDFDNRLVNHF 245
Query  243  VKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRAR 302
            V+EFKRK  KD+ +N RALRRLRTSCERAKRTLSS+ QTSIEIDSL EGIDFY++ITRAR
Sbjct  246  VQEFKRKFGKDIMSNKRALRRLRTSCERAKRTLSSSTQTSIEIDSLHEGIDFYSTITRAR 305
Query  303  FEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN-KDPNK 361
            FEELC+DLFRST+EPVE+ LRDAK DKS ++EIVLVGGSTRIPKIQ+L++DFFN K+ NK
Sbjct  306  FEELCSDLFRSTLEPVEKALRDAKLDKSKIDEIVLVGGSTRIPKIQKLLSDFFNGKELNK 365
Query  362  SINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTTI 421
            SINPDEA+AYGAAVQA+IL+GD +S +  ++LLLDVAPLSLGIETAGGVMT LIKR+TTI
Sbjct  366  SINPDEAVAYGAAVQAAILTGD-NSNNVKDLLLLDVAPLSLGIETAGGVMTTLIKRNTTI 424
Query  422  PTRSPRLSLPT-----PTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRG 476
            PT+  + ++ T     P  + +  +   R          ++  +  P +P          
Sbjct  425  PTKQTQ-TFTTYADNQPAVT-IQVYEGERAMTKDNNRLGTFDLTGIPPAPRG--VPQIEV 480
Query  477  HFDVDANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARI 536
             FDVDANGI+NV AV+K TG+ NKITITNDKGRLSK +IE+M+ EAE+Y+ +DE +  RI
Sbjct  481  TFDVDANGILNVSAVDKSTGRQNKITITNDKGRLSKADIEKMVQEAEQYREDDERQRERI 540
Query  537  HAKNGPESYAYSLRNTVNEG--KLSISDSDKE 566
             AKN  E+YA+ L++T+ E   K  +S+ D++
Sbjct  541  AAKNQLEAYAFQLKSTMEEEAVKSKLSEEDRK 572

Sequence Alignment: 6. Allergen Name: Pen c 19 Sequence ID: Q92260

 Score = 502.0 bits 2175,  Expect = 4e-143
 Identities = 357/440 81%, Positives = 385/440 87%, Gaps = 6/440 1%
Query  133  AYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIAYGLDKKGGAG 192
            AYLGGTVNNAVITVPAYFNDSQRQATKD+GLIAGLNVLRIINEPTAAAIAYGLDKK   G
Sbjct  1    AYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKT-EG 59
Query  193  ERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVKEFKRKHKK 252
            ERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFV EFKRKHKK
Sbjct  60   ERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVNEFKRKHKK 119
Query  253  DLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFEELCADLFR 312
            DLTTNARALRRLRT+CERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFEELC DLFR
Sbjct  120  DLTTNARALRRLRTACERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFEELCQDLFR 179
Query  313  STMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFNKDPNKSINPDEAIAYG 372
             TMEPVERVLRDAK DKSSV+EIVLVGGSTRIPKIQ+LV+DFFNKD NKSINPDEA+AYG
Sbjct  180  GTMEPVERVLRDAKIDKSSVHEIVLVGGSTRIPKIQKLVSDFFNKDANKSINPDEAVAYG 239
Query  373  AAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTTIPTR-SPRLSLP 431
            AAVQA+ILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMT LIKR+TTIPT+ S  +S  
Sbjct  240  AAVQAAILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTPLIKRNTTIPTKKSETFSTY 299
Query  432  TPTTS--LVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGHFDVDANGIMNVG 489
            +      L+  F   R           +  +  P +P           FD+DANGIMNV 
Sbjct  300  SDNQPGVLIQVFEGERARTKDNNLLGKFELTGIPPAPRG--VPQIEVTFDLDANGIMNVS 357
Query  490  AVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKNGPESYAYSL 549
            A EKGTGK+NKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEA+RI+AKNG ESYAYSL
Sbjct  358  ASEKGTGKSNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEASRIQAKNGLESYAYSL 417
Query  550  RNTVNEGKLSISDSDKEKLRARLTRL 575
            +NT+ EGKL +SD DK+K+  +++ +
Sbjct  418  KNTITEGKLQMSDDDKKKIEDKISEI 443

Sequence Alignment: 7. Allergen Name: Cor a 10 Sequence ID: CAC14168

 Score = 486.4 bits 2107,  Expect = 3e-138
 Identities = 335/559 59%, Positives = 430/559 76%, Gaps = 13/559 2%
Query  7    IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPSNT 66
            IGIDLGTTYSCVGV+++G VEIIANDQGNR TPS+VGFTD ERLIG+AAKNQ A+NP  T
Sbjct  39   IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERT 98
Query  67   VFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFK-GETKQFIPEEISSMVLV 125
            +FD KRLIGRKF++  VQ DMK  P+K++ K  KP I+V+ K GETK F PEEIS+M+L+
Sbjct  99   IFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILI 158
Query  126  KMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIAYGL 185
            KM+ETAEA+LG  + +AV+TVPAYFND+QRQATKD+G+IAGLNV RIINEPTAAAIAYGL
Sbjct  159  KMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYGL 218
Query  186  DKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVKE 245
            DKKGG  E+N+L+FDLGGGTFDVS+LTI+ G+FEV ST GDTHLGGEDFD R++ +F+K 
Sbjct  219  DKKGG--EKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDMRIMEYFIKL 276
Query  246  FKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFEE 305
             K+KH KD++ + RA+ +LR   ERAKR LSS  Q  +EI+SLF+G+DF   +TRARFEE
Sbjct  277  IKKKHGKDISKDNRAIGKLRREAERAKRALSSQHQVRVEIESLFDGVDFSEPLTRARFEE 336
Query  306  LCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN-KDPNKSIN 364
            L  D+ +      E  + DA   K+ ++EIVLVGGSTRIPK+Q+L+ D+F+ K+PNK +N
Sbjct  337  LNNDFVQKDHGTREEAMEDAGLAKNQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVN 396
Query  365  PDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTTIPTR 424
            PDEA+AYGAAVQ SILSG+   + T +ILLLDVAPL+LGIET GGVMT LI R+T IPT+
Sbjct  397  PDEAVAYGAAVQGSILSGE-GGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTK 455
Query  425  SPRLSLP---TPTTSLVSRFRSTRVSVLAPRTTTSLVSSSSPVSPCSSWCSSDRGHFDVD 481
              ++        TT  +  F   R      R    +  +  P +P  +        F+VD
Sbjct  456  KSQVFTTYQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGVPPAPRGT--PQIEVTFEVD 513
Query  482  ANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKNG 541
            ANGI+NV A +KGTGK+ KITITNDKGRLS+EEI+RM+ EAE++  ED+    RI A+N 
Sbjct  514  ANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVQEAEEFAEEDKKVKERIDARNT 573
Query  542  PESYAYSLRNTVNE-GKLS--ISDSDKEKLRA 570
             E+Y Y+++N VN+  KL+  +   +K+K+ +
Sbjct  574  LETYVYNMKNQVNDKDKLADKLESDEKDKIES 605

Sequence Alignment: 8. Allergen Name: Aed a 8.0101 Sequence ID: Q1HR69

 Score = 480.7 bits 2082,  Expect = 1e-136
 Identities = 336/552 60%, Positives = 430/552 77%, Gaps = 21/552 3%
Query  7    IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFT-DTERLIGDAAKNQVAMNPSN 65
            +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYV FT D ERLIGDAAKNQ+  NP N
Sbjct  32   VGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPEN 91
Query  66   TVFDAKRLIGRKFDETTVQADMKHWPFKVIEKGNKPAIEVEFKGETKQFIPEEISSMVLV 125
            TVFDAKRLIGR+F ++TVQ D K  PFKVIEK +KP I+V      K F PEEIS+MVL 
Sbjct  92   TVFDAKRLIGREFTDSTVQHDAKLLPFKVIEKNSKPHIKVSTSQGDKVFAPEEISAMVLG 151
Query  126  KMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAAAIAYGL 185
            KM+ETAEAYLG  V +AV+TVPAYFND+QRQATKD+G+IAGLNV+RIINEPTAAAIAYGL
Sbjct  152  KMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVMRIINEPTAAAIAYGL 211
Query  186  DKKGGAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVKE 245
            DKK   GE+NVL+FDLGGGTFDVSLLTI+ G+FEV +T GDTHLGGEDFD R+++HF+K 
Sbjct  212  DKKD--GEKNVLVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKL 269
Query  246  FKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARFEE 305
            +K+K  KD+  + RA+++LR   E+AKR LSS+ Q  IEI+S++EG DF  ++TRA+FEE
Sbjct  270  YKKKKGKDIRKDNRAVQKLRREVEKAKRALSSSHQVRIEIESFYEGDDFSETLTRAKFEE 329
Query  306  LCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN-KDPNKSIN 364
            L  DLFRSTM+PV++VL DA  +K  V+EIVLVGGSTRIPK+Q+LV +FFN K+P++ IN
Sbjct  330  LNMDLFRSTMKPVQKVLEDADMNKKDVDEIVLVGGSTRIPKVQQLVKEFFNGKEPSRGIN 389
Query  365  PDEAIAYGAAVQASILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTALIKRDTTIPTR 424
            PDEA+AYGAAVQA +LSG+   + T  I+LLDV PL++GIET GGVMT LI R+T IPT+
Sbjct  390  PDEAVAYGAAVQAGVLSGE---QDTEAIVLLDVNPLTMGIETVGGVMTKLIPRNTVIPTK 446
Query  425  SPRL-SLPTPT--TSLVSRFRSTRVSVLAPRTTTSLVSSS---SPVSPCSSWCSSDRGHF 478
              ++ S  +    T  +  +   R     P T  + +      + + P           F
Sbjct  447  KSQIFSTASDNQHTVTIQVYEGER-----PMTKDNHLLGKFDLTGIPPAPRGIPQIEVSF 501
Query  479  DVDANGIMNVGAVEKGTGKTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHA 538
            ++DANGI+ V A +KGTG   KI ITND+ RL+ E+IERM+ +AE++  +D+    R+ A
Sbjct  502  EIDANGILQVSAEDKGTGNREKIVITNDQNRLTPEDIERMIKDAERFADDDKKLKERVEA 561
Query  539  KNGPESYAYSLRNTV-NEGKLS--ISDSDKEKL 568
            +N  ESYAYSL+N + ++ KL   ++D DK  +
Sbjct  562  RNELESYAYSLKNQLGDKDKLGAKVADDDKATM 594

Sequence Alignment: 9. Allergen Name: Mala s 10 Sequence ID: CAD20981

 Score = 188.2 bits 799,  Expect = 2e-48
 Identities = 177/558 31%, Positives = 298/558 53%, Gaps = 63/558 11%
Query  4    TPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNP 63
            +  +G+D+G + S +GV +   V+I++N+  NR+TPS V F    RL+G+ A      N 
Sbjct  2    SSVVGLDIGNSSSKIGVARARGVDIVSNEVSNRSTPSLVSFGQKARLLGEGAATAQTSNF 61
Query  64   SNTVFDAKRLIGRKFDETTVQADMKHWPF---KVIEKGNKPAIEVEFKGETKQFIPEEIS 120
             NTV   KRLIGR F + ++Q   K  PF   ++++   +  ++V F+ E   F   ++ 
Sbjct  62   KNTVGSLKRLIGRTFQDESIQTYEK--PFVNAELVDAKGEVGVKVRFQNEEHIFSATQLL 119
Query  121  SMVLVKMRETAEAYLGGT-VNNAVITVPAYFNDSQRQATKDSGLIAGLNVLRIINEPTAA 179
            +M L K+ +T +  LGG+ V++ V++VP +F D+QR+A   +  IA LN LR++NEPTA 
Sbjct  120  AMYLGKLLDTTQNELGGSGVSDVVLSVPIWFTDAQRRAMLHAAEIANLNPLRVMNEPTAT 179
Query  180  AIAYGLDKKG---GAGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDN 236
            A+ YG+ K         RNV+  D+G  ++ VS++   +G + V     D ++GG +FD 
Sbjct  180  ALGYGITKTDLPEPDSPRNVIFVDIGHSSYQVSVVAFCKGQLTVLGAWADPNFGGRNFDR 239
Query  237  RLVNHFVKEFKRKHKKDLTTNARALRRLRTSCERAKRTLSSAAQTSIEIDSLFEGIDFYT 296
             L+ HF +EFK K+K D+  N +A  RL   CER K+ LS+     + ++SL   ID  +
Sbjct  240  VLMEHFAEEFKGKYKIDVFFNPKATFRLAAGCERLKKVLSANTLAQLNVESLMNDIDAAS 299
Query  297  SITRARFEELCADLFRSTMEPVERVLRDAKTDKSSVNEIVLVGGSTRIPKIQRLVADFFN 356
             + R  FE L A  +     P++  L  +   K  ++ + LVGGS+R+P ++  +A ++ 
Sbjct  300  QLKRDEFESLIAPYLERVNGPLDAALSQSGLTKDEIHSVELVGGSSRVPALKERIAAWYG 359
Query  357  KDPNKSINPDEAIAYGAAVQASILSGDTSSKSTNEILLLDVA--PLSLGIETAGGVMTAL 414
            K  + ++N DEAI  G  +  + LS     +   E  + D++  P+ +  E A  V    
Sbjct  360  KPLSYTLNQDEAIVRGCTLACATLSPVFRVR---EFSVHDISSYPIKVSWEPAPDVP--- 413
Query  415  IKRDTTIPTRSPRLSLPTPTTSLVSRFRSTRVSVLAPRTTTS-LVSSSSPV---SPCSSW 470
               D          + P P+T +++ +R    S+ A     S L   ++P        + 
Sbjct  414  ---DEENELVVFNTNNPVPSTKILTFYRKEPFSLDATYADASTLPKGTNPWLGRVTIKNV 470
Query  471  CSSDRGHFDV-------DANGIMNV--------------------GAVEKGTGKTNK--- 500
              +++G   +       + +G++NV                     A E    KT K   
Sbjct  471  APNEKGEHSIVKVKARLNLHGVLNVESAYTVDEIEKEEEVPVVDPNAAEDAEPKTEKKIV 530
Query  501  --------ITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKNGPESYAYSLRNT 552
                    + I +  G L    +  +     +  A D+  A     KN  E Y Y  R+ 
Sbjct  531  KKLQRKDDLPIVSGIGLLDPTLLAELKEREGQMYAADKLVADTEDRKNALEEYIYDTRSK 590
Query  553  VNEGKLSISDSD-KEKLRARL 572
            ++E   +   S+ KEKL A L
Sbjct  591  LDERYATFVQSEEKEKLLAML 611

Sequence Alignment: 10. Allergen Name: Alt a 3 Sequence ID: AAB48042

 Score = 84.5 bits 339,  Expect = 5e-18
 Identities = 58/78 74%, Positives = 66/78 84%, Gaps = 2/78 2%
Query  497  KTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKNGPESYAYSLRNTVNEG 556
            KTNKI ITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARI AKN  ESYAYSLRNT+++ 
Sbjct  1    KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDS 60
Query  557  KLS--ISDSDKEKLRARLTR 574
            K+   +   DK+KL A + +
Sbjct  61   KVDEKLDAGDKQKLTAEIDK 80

Sequence Alignment: 11. Allergen Name: Alt a 3 Sequence ID: P78983

 Score = 84.2 bits 339,  Expect = 8e-18
 Identities = 58/78 74%, Positives = 66/78 84%, Gaps = 2/78 2%
Query  497  KTNKITITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIHAKNGPESYAYSLRNTVNEG 556
            KTNKI ITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARI AKN  ESYAYSLRNT+++ 
Sbjct  1    KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDS 60
Query  557  KLS--ISDSDKEKLRARLTR 574
            K+   +   DK+KL A + +
Sbjct  61   KVDEKLDAGDKQKLTAEIDK 80

Sequence Alignment: 12. Allergen Name: Der f mag29 Sequence ID: BAA04556

 Score = 43.4 bits 160,  Expect = 1e-05
 Identities = 26/57 45%, Positives = 41/57 71%, Gaps = 2/57 3%
Query  512  KEEIERMLAEAEKYKAEDEAEAARIHAKNGPESYAYSLRNTVNEG--KLSISDSDKEKL 568
            K++IERM+ EAE YK ED+ +  RI AKN  E YA+ ++ T++E   K  +S+ D++K+
Sbjct  1    KDDIERMVKEAESYKEEDDKQRDRIAAKNSLEGYAFQMKATLDEEAIKSKVSEEDRKKI 59

Sequence Alignment: 13. Allergen Name: Alt a 3 Sequence ID: AAB48043

 Score = 37.8 bits 134,  Expect = 0.0005
 Identities = 24/43 55%, Positives = 32/43 74%, Gaps = 2/43 4%
Query  532  EAARIHAKNGPESYAYSLRNTVNEGKLS--ISDSDKEKLRARLTR 574
            EAARI AKN  ESYAYSLRNT+++ K+   +   DK+KL A + +
Sbjct  1    EAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDK 45

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.