The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF
MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS
WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL
Sequence Info Allergen Name Length Opt Bits Score E Value
ALM24136 Rhi o 2.0101 164 1128 264.2 1.3e-72
A1KXG2 Der f 29.0101 164 910 214.5 1.2e-57
AJ937743 Asp f 27.0101 163 794 188.1 1e-49
CAA59468 Cat r 1.0101 172 792 187.6 1.5e-49
QAT18640 Der p 29.0101 247 789 186.8 3.9e-49
CAA09884 Mala s 6 162 777 184.2 1.5e-48
AVV30163 Ole e 15.0101 172 777 184.2 1.6e-48
A0A444XS96 Ara h 18.0101 226 779 184.5 1.7e-48
P21568 Sola l 5.0101 171 769 182.4 5.8e-48
Q8L5T1 Bet v 7 173 768 182.1 6.9e-48
CAB44442 Asp f 11 178 615 147.2 2.3e-37
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Rhi o 2.0101 Sequence ID: ALM24136

 Score = 264.2 bits 1128,  Expect = 1e-72
 Identities = 164/164 100%, Positives = 164/164 100%, Gaps = 0/164 0%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF 60
            MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF
Sbjct  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF 60
Query  61   MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS 120
            MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS
Sbjct  61   MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS 120
Query  121  WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL
Sbjct  121  WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164

Sequence Alignment: 2. Allergen Name: Der f 29.0101 Sequence ID: A1KXG2

 Score = 214.5 bits 910,  Expect = 1e-57
 Identities = 125/164 76%, Positives = 147/164 89%, Gaps = 0/164 0%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF 60
            M+ P+VFFD++A+++PLGRIV+ELR+DVVP+TAENFRALCTGEKGFG+K  SFHR+IP F
Sbjct  1    MALPRVFFDIAADNQPLGRIVIELRSDVVPKTAENFRALCTGEKGFGFKSSSFHRIIPNF 60
Query  61   MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS 120
            M+QGGDFTNHNGTGGKSIYGNKF DENFTL+HTGPG +SMANAGPNTNGSQFFITT+K +
Sbjct  61   MIQGGDFTNHNGTGGKSIYGNKFADENFTLQHTGPGIMSMANAGPNTNGSQFFITTVKTT 120
Query  121  WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            WLDGKHVVFG V EGMD+V+ +ES GS +G P  K+ I NCGQL
Sbjct  121  WLDGKHVVFGSVVEGMDIVKKVESYGSQSGKPSKKVTIANCGQL 164

Sequence Alignment: 3. Allergen Name: Asp f 27.0101 Sequence ID: AJ937743

 Score = 188.1 bits 794,  Expect = 1e-49
 Identities = 113/160 70%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  5    KVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEFMLQG 64
            K FFD++ + +P GRI  +L  +VVP+T ENFRALCTGEKGFGYKG SFHR+IP+FMLQG
Sbjct  4    KTFFDITIDGQPAGRITFKLFDEVVPKTVENFRALCTGEKGFGYKGSSFHRIIPQFMLQG 63
Query  65   GDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCSWLDG 124
            GDFT  NGTGGKSIYG++F DENF LKH  PG LSMANAG NTNGSQFFITT+  SWLDG
Sbjct  64   GDFTKGNGTGGKSIYGDRFPDENFQLKHDKPGLLSMANAGKNTNGSQFFITTVVTSWLDG 123
Query  125  KHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
             HVVFG V +GMD+V+ IES GS +GTP+ KI I +CGQL
Sbjct  124  AHVVFGEVEDGMDLVKKIESYGSASGTPKKKITIADCGQL 163

Sequence Alignment: 4. Allergen Name: Cat r 1.0101 Sequence ID: CAA59468

 Score = 187.6 bits 792,  Expect = 2e-49
 Identities = 118/164 71%, Positives = 132/164 80%, Gaps = 7/164 4%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSF 53
            M NP+VFFD+S   +P GRIVMEL AD  P+TAENFRALCTGEKG G       YK  SF
Sbjct  1    MPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSF 60
Query  54   HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFF 113
            HRVIP FM QGGDFT  NGTGG+SIYG KF DENF  KHTGPG LSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFF 120
Query  114  ITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            I T K  WLDGKHVVFG+V EGMDVV+ IE +GS +G    K+++++CGQL
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQL 171

Sequence Alignment: 5. Allergen Name: Der p 29.0101 Sequence ID: QAT18640

 Score = 186.8 bits 789,  Expect = 4e-49
 Identities = 109/163 66%, Positives = 132/163 80%, Gaps = 0/163 0%
Query  2    SNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEFM 61
            +NP+VFFD+  +++  GRIV+ LR DVVP+T ENFR LCT EKGFG++G  FHR+IP FM
Sbjct  84   TNPQVFFDIRVDNQYCGRIVILLRKDVVPKTTENFRCLCTHEKGFGFRGSIFHRIIPGFM 143
Query  62   LQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCSW 121
            +QGGDFTNHNGTGGKSIYG KF DENF LKHTG G LSMAN+GPNTNGSQFFIT  +  W
Sbjct  144  IQGGDFTNHNGTGGKSIYGRKFEDENFQLKHTGAGTLSMANSGPNTNGSQFFITASRTEW 203
Query  122  LDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            LDGKHVVFG+V +GMD+V+ IE  GS +G P  ++ I NCG++
Sbjct  204  LDGKHVVFGQVMQGMDIVRKIEECGSKSGKPNKRVKIANCGEF 246

Sequence Alignment: 6. Allergen Name: Mala s 6 Sequence ID: CAA09884

 Score = 184.2 bits 777,  Expect = 2e-48
 Identities = 116/160 72%, Positives = 129/160 80%, Gaps = 2/160 1%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEF 60
            MSN  VFFD++ N  PLG I  +L  DVVP+TA NFRALCTGEKGFGY G  FHRVIP+F
Sbjct  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDF 58
Query  61   MLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIKCS 120
            MLQGGDFT  NGTGGKSIYG KF DENF LKH  PG LSMANAGPNTNGSQFFITT+  S
Sbjct  59   MLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTS 118
Query  121  WLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCG 162
            WLDGKHVVFG V +GM+VV+ IE+ GS +G PR++I I  CG
Sbjct  119  WLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG 160

Sequence Alignment: 7. Allergen Name: Ole e 15.0101 Sequence ID: AVV30163

 Score = 184.2 bits 777,  Expect = 2e-48
 Identities = 115/164 70%, Positives = 133/164 81%, Gaps = 7/164 4%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSF 53
            M+NPKVFFD++   +P+GRIVMEL ADVVP+T+ENFRALCTGEKG G       YKG +F
Sbjct  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
Query  54   HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFF 113
            HRVIP FM QGGDFT  NGTGG+SIYG+KF DENF  KHTGPG LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  114  ITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            I T K  WLDGKHVVFG+V EG  VV+ IE +GS +G     +++ +CGQL
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171

Sequence Alignment: 8. Allergen Name: Ara h 18.0101 Sequence ID: A0A444XS96

 Score = 184.5 bits 779,  Expect = 2e-48
 Identities = 114/164 69%, Positives = 132/164 80%, Gaps = 7/164 4%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSF 53
            M+NP+VFFD++   +P GRI+MEL AD  P+TAENFRALCTGEKG G       YKG SF
Sbjct  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
Query  54   HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFF 113
            HRVIP FM QGGDFT  NGTGG+SIYG+KF DENF  KHTGPG LSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
Query  114  ITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            I T K  WLDGKHVVFG+V EG+DVV+ IE +GS +G     +++ +CGQL
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171

Sequence Alignment: 9. Allergen Name: Sola l 5.0101 Sequence ID: P21568

 Score = 182.4 bits 769,  Expect = 6e-48
 Identities = 113/164 68%, Positives = 130/164 79%, Gaps = 7/164 4%
Query  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSF 53
            M+NPKVFFD++    P GR+VMEL AD  P+TAENFRALCTGEKG G       YKG +F
Sbjct  1    MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF 60
Query  54   HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFF 113
            HRVIP FM QGGDFT  NGTGG+SIYG KF DENF  KHTGPG LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  114  ITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
            I T K  WL+GKHVVFG+V EGMDV++  E++GS +G     ++I +CGQL
Sbjct  121  ICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171

Sequence Alignment: 10. Allergen Name: Bet v 7 Sequence ID: Q8L5T1

 Score = 182.1 bits 768,  Expect = 7e-48
 Identities = 114/163 69%, Positives = 129/163 79%, Gaps = 7/163 4%
Query  2    SNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSFH 54
            SNPKVFFD+    +P+GRIVMEL AD  P+TAENFRALCTGEKG G       YK  SFH
Sbjct  3    SNPKVFFDMEVGGQPVGRIVMELYADTTPRTAENFRALCTGEKGNGRSGKPLHYKKSSFH 62
Query  55   RVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFI 114
            RVIP FM QGGDFT  NGTGG+SIYG KF DENF  KHTGPG LSMANAGP TNGSQFFI
Sbjct  63   RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFI 122
Query  115  TTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164
             T K  WLDGKHVVFG+V EG+D+V+ IE +GS +G     +++ +CGQL
Sbjct  123  CTAKTEWLDGKHVVFGQVVEGLDIVKAIEKVGSSSGRTSKPVVVADCGQL 172

Sequence Alignment: 11. Allergen Name: Asp f 11 Sequence ID: CAB44442

 Score = 147.2 bits 615,  Expect = 2e-37
 Identities = 100/159 62%, Positives = 121/159 76%, Gaps = 11/159 6%
Query  5    KVFFDV------SANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIP 58
            +VFFDV      +A +K +GRIV  L    VP+TA+NFR LC    G GY+  +FHR+IP
Sbjct  10   QVFFDVEYAPVGTAETK-VGRIVFNLFDKDVPKTAKNFRELCKRPAGEGYRESTFHRIIP 68
Query  59   EFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFFITTIK 118
             FM+QGGDFT  NGTGG+SIYG+KF DENF+ KH   G LSMANAGPNTNGSQFFITT  
Sbjct  69   NFMIQGGDFTRGNGTGGRSIYGDKFADENFSRKHDKKGILSMANAGPNTNGSQFFITTAV 128
Query  119  CSWLDGKHVVFGRVTE--GMDVVQNIESLGSPNGTPRA--KIIIDNCGQL 164
             SWLDGKHVVFG V +     VV+ IE+LGS +G+ R+  +  I NCG+L
Sbjct  129  TSWLDGKHVVFGEVADEKSYSVVKEIEALGSSSGSVRSNTRPKIVNCGEL 178

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.