The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV
AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL
GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA
QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV
DIINAKQ
Sequence Info Allergen Name Length Opt Bits Score E Value
ACM09737 Sal s 8.01 247 1651 383.0 4.9e-108
XP_026795867 Pan h 8.0101 248 1403 326.5 5.2e-91
AIO08860 Der f 25.0201 247 1156 270.2 4.6e-74
QAT18637 Der p 25.0101 247 1148 268.4 1.6e-73
A0A1L5YRA2 Scy p 8.0101 248 1089 254.9 1.8e-69
L7UZA7 Der f 25.0101 247 1087 254.5 2.5e-69
F5A6E97 Pro c 8.0101 248 1071 250.8 3.1e-68
CAC14917 Tri a 31.0101 253 1021 239.4 8.7e-65
CAC14917 Tri a TPIS 253 1021 239.4 8.7e-65
Q8T5G9 Arc s 8.0101 224 974 228.8 1.2e-61
F8QN77 Pen m 8.0101 266 907 213.4 6.1e-57
Q0CJH1 Asp t 36.0101 249 877 206.6 6.5e-55
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal s 8.01 Sequence ID: ACM09737

 Score = 383.0 bits 1651,  Expect = 5e-108
 Identities = 247/247 100%, Positives = 247/247 100%, Gaps = 0/247 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
            MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV
Sbjct  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
Query  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
            AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL
Sbjct  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
Query  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
            GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA
Sbjct  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
Query  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
            QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV
Sbjct  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
Query  241  DIINAKQ 247
            DIINAKQ
Sbjct  241  DIINAKQ 247

Sequence Alignment: 2. Allergen Name: Pan h 8.0101 Sequence ID: XP_026795867

 Score = 326.5 bits 1403,  Expect = 5e-91
 Identities = 211/244 86%, Positives = 223/244 91%, Gaps = 0/244 0%
Query  3    RKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAA 62
            RKFFVGGNWKMNGDK SLGELI TLNSA L+ +TEVVCGAPSIYL+FARSKLD KIGVAA
Sbjct  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
Query  63   QNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGV 122
            QNCYKV  GAFTGEISPAMIKD GV WVILGHSERR VFGE+DELIGQK AHALE GLGV
Sbjct  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
Query  123  IACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQD 182
            IACIGEKLDEREAGITEKV+ AQTK  ADN+KDWSKVV+AYEPVWAIGTGKTASP QAQ+
Sbjct  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
Query  183  VHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFVDI 242
            VHDKLRQW+ AN+SEAVANSVRIIYGGSVTG TCKEL   KDVDGFLVGGA+LKPEFV+I
Sbjct  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
Query  243  INAK 246
            INAK
Sbjct  244  INAK 247

Sequence Alignment: 3. Allergen Name: Der f 25.0201 Sequence ID: AIO08860

 Score = 270.2 bits 1156,  Expect = 5e-74
 Identities = 173/247 70%, Positives = 198/247 80%, Gaps = 0/247 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
            M RKFFVGGNWKMNG +A+  +LIKTL++  LDPNT+VV G PSIY+   R KL   IGV
Sbjct  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
Query  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
            AAQNCYKV  GAFTGEISPAMIKDVG  WVILGHSERR VFGE+D+LIG+K  HAL+ GL
Sbjct  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
Query  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
             VIACIGE L+EREAG T +V+  QT+  + ++KDWSKVVLAYEPVWAIGTGKTASP QA
Sbjct  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
            Q+VH KLRQW   NVS  +A ++RIIYGGSVT    KEL    DVDGFLVGGA+LKPEFV
Sbjct  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  DIINAKQ 247
             I+NA+Q
Sbjct  241  QIVNARQ 247

Sequence Alignment: 4. Allergen Name: Der p 25.0101 Sequence ID: QAT18637

 Score = 268.4 bits 1148,  Expect = 2e-73
 Identities = 171/247 69%, Positives = 194/247 78%, Gaps = 0/247 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
            M RKFFVGGNWKMNG +A+  +LIK L +  LDPNTEVV G PSIYL   R KL   IGV
Sbjct  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
Query  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
            AAQNCYKV  GAFTGEISPAMIKDVG  WVILGHSERR VFGE D+LIG+K  HAL  GL
Sbjct  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
Query  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
             VIACIGE ++EREAG T +V+  QT+  + ++KDWSKVVLAYEPVWAIGTGKTASP QA
Sbjct  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
            Q+VH +LRQW   N+S  +A ++RIIYGGSVT    KEL    DVDGFLVGGA+LKPEFV
Sbjct  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  DIINAKQ 247
             I+NA+Q
Sbjct  241  QIVNARQ 247

Sequence Alignment: 5. Allergen Name: Scy p 8.0101 Sequence ID: A0A1L5YRA2

 Score = 254.9 bits 1089,  Expect = 2e-69
 Identities = 163/243 67%, Positives = 188/243 77%, Gaps = 1/243 0%
Query  3    RKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAA 62
            RKFFVGGNWKMNGDKA++  +I  +    L+ +TEVV G P  YL + R  +   IGVAA
Sbjct  5    RKFFVGGNWKMNGDKAAIDGIISFMKGP-LNADTEVVVGCPQCYLMYTREHMPANIGVAA 63
Query  63   QNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGV 122
            QNCYK   GAFTGEISPAMIKD G  WVILGHSERR VFGE D+LI +K  HALE GL V
Sbjct  64   QNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVFGEPDQLISEKVGHALEAGLKV 123
Query  123  IACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQD 182
            I CIGEKL+ERE+  TE+V+ AQ K +  NI DWS+VV+AYEPVWAIGTGKTA+P QAQD
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQD 183
Query  183  VHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFVDI 242
            VH KLRQW++ NVS  VA S RIIYGGSV+ G CKEL    D+DGFLVGGA+LKP+FV I
Sbjct  184  VHAKLRQWLRDNVSPQVAESTRIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPDFVTI 243
Query  243  INAK 246
            INA+
Sbjct  244  INAR 247

Sequence Alignment: 6. Allergen Name: Der f 25.0101 Sequence ID: L7UZA7

 Score = 254.5 bits 1087,  Expect = 2e-69
 Identities = 164/247 66%, Positives = 192/247 77%, Gaps = 0/247 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
            M RKFFVGGNWKMNG+K ++ E++  L +  LD N EVV G P+IYL + ++ L   I V
Sbjct  1    MGRKFFVGGNWKMNGNKTAIKEIVDFLKNGPLDSNVEVVVGVPAIYLMLCKNILPDNIRV 60
Query  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
            AAQNCYKV  GAFTGEISPAMIKDVG  WVILGHSERR VFGE+D+LIG+K  HAL+ GL
Sbjct  61   AAQNCYKVDKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
Query  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
             VIACIGE L+EREAG T +V+  QT+  + ++KDW KVVLAYEPVWAIGTGKTASP QA
Sbjct  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWFKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
            Q+VH KLRQ    NVS  +A ++RIIYGGSVT    KEL    DVDGFLVGGA+LKPEFV
Sbjct  181  QEVHQKLRQCFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  DIINAKQ 247
             I+NA+Q
Sbjct  241  QIVNARQ 247

Sequence Alignment: 7. Allergen Name: Pro c 8.0101 Sequence ID: F5A6E97

 Score = 250.8 bits 1071,  Expect = 3e-68
 Identities = 161/243 66%, Positives = 186/243 76%, Gaps = 1/243 0%
Query  3    RKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAA 62
            RKFFVGGNWKMNGD+A +  +I  +    L  +TEVV G P  YL + R  L   IGVAA
Sbjct  5    RKFFVGGNWKMNGDRAGIDSIISFMKGP-LSADTEVVVGCPQCYLMYTREHLPSNIGVAA 63
Query  63   QNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGV 122
            QNCYKV  GAFTGEISP+MIKD G  WVILGHSERR VF E D LI +K  HALE GL V
Sbjct  64   QNCYKVAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKV 123
Query  123  IACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQD 182
            I CIGEKL+ERE+  TE+V+ AQ K +  NI DWS+VV+AYEPVWAIGTGKTA+P QAQ+
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQE 183
Query  183  VHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFVDI 242
            VH KLRQW++ NV+  VA+S RIIYGGSVT G CKEL    D+DGFLVGGA+LKP+FV I
Sbjct  184  VHAKLRQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGGASLKPDFVQI 243
Query  243  INAK 246
            INA+
Sbjct  244  INAR 247

Sequence Alignment: 8. Allergen Name: Tri a 31.0101 Sequence ID: CAC14917

 Score = 239.4 bits 1021,  Expect = 9e-65
 Identities = 152/245 62%, Positives = 184/245 75%, Gaps = 2/245 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPN--TEVVCGAPSIYLEFARSKLDPKI 58
            M RKFFVGGNWK NG    +  ++ TLN+ ++      EVV   P ++L   + KL P+I
Sbjct  1    MGRKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEI 60
Query  59   GVAAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALEN 118
             VAAQNC+  KGGAFTGE+S  M+ ++GV WVILGHSERR + GE+ E++G+K A+AL  
Sbjct  61   QVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQ 120
Query  119  GLGVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPA 178
            GL VIAC+GE L++REAG T  V+  QTK  AD IKDW+ VV+AYEPVWAIGTGK ASPA
Sbjct  121  GLKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPA 180
Query  179  QAQDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPE 238
            QAQ+VH  LR W+K NVS  VA S RIIYGGSVTG +CKEL    DVDGFLVGGA+LKPE
Sbjct  181  QAQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPE 240
Query  239  FVDIINA 245
            F+DIINA
Sbjct  241  FIDIINA 247

Sequence Alignment: 9. Allergen Name: Tri a TPIS Sequence ID: CAC14917

 Score = 239.4 bits 1021,  Expect = 9e-65
 Identities = 152/245 62%, Positives = 184/245 75%, Gaps = 2/245 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPN--TEVVCGAPSIYLEFARSKLDPKI 58
            M RKFFVGGNWK NG    +  ++ TLN+ ++      EVV   P ++L   + KL P+I
Sbjct  1    MGRKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEI 60
Query  59   GVAAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALEN 118
             VAAQNC+  KGGAFTGE+S  M+ ++GV WVILGHSERR + GE+ E++G+K A+AL  
Sbjct  61   QVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQ 120
Query  119  GLGVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPA 178
            GL VIAC+GE L++REAG T  V+  QTK  AD IKDW+ VV+AYEPVWAIGTGK ASPA
Sbjct  121  GLKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPA 180
Query  179  QAQDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPE 238
            QAQ+VH  LR W+K NVS  VA S RIIYGGSVTG +CKEL    DVDGFLVGGA+LKPE
Sbjct  181  QAQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPE 240
Query  239  FVDIINA 245
            F+DIINA
Sbjct  241  FIDIINA 247

Sequence Alignment: 10. Allergen Name: Arc s 8.0101 Sequence ID: Q8T5G9

 Score = 228.8 bits 974,  Expect = 1e-61
 Identities = 147/224 65%, Positives = 169/224 75%, Gaps = 1/224 0%
Query  8    GGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAAQNCYK 67
            GGNWKMNGD+AS+  +I  +    L  +TEVV G P  YL + R  L   IGVAAQNCYK
Sbjct  1    GGNWKMNGDRASIDSIISFMKGP-LSGDTEVVVGCPQCYLMYTREHLPSNIGVAAQNCYK 59
Query  68   VKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGVIACIG 127
            V  GAFTGEISP+MIKD G  WVILGHSERR VF E D LI +K  HALE GL VI CIG
Sbjct  60   VAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKVIPCIG 119
Query  128  EKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQDVHDKL 187
            EKL+ERE+  TE+V+ AQ K +  NI DWS+VV+AYEPVWAIGTGKTA+P QAQ+VH KL
Sbjct  120  EKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQEVHAKL 179
Query  188  RQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGG 232
            RQW++ NV+  VA+S RIIYGGSVT G CKEL    D+DGFLVGG
Sbjct  180  RQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGG 224

Sequence Alignment: 11. Allergen Name: Pen m 8.0101 Sequence ID: F8QN77

 Score = 213.4 bits 907,  Expect = 6e-57
 Identities = 132/245 53%, Positives = 173/245 70%, Gaps = 0/245 0%
Query  3    RKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAA 62
            RKFFV GNWKMN DK  +  ++K +N+A LD NTE V G PS YL +AR  L   IG+AA
Sbjct  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
Query  63   QNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGV 122
            QNCYKV  G F+GEISP MIKD G  WVILGH ERR VF E D +I +K AHA E G+ +
Sbjct  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
Query  123  IACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQD 182
            IAC+ E  D+R+ G TE+V+  Q   +A  I DWS+VVLA+E +WA  TG  A+  Q QD
Sbjct  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
Query  183  VHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFVDI 242
                +R W++ NVS+ VA++ R+IY GSV+   C+E+  ++++DGFLVGGA+LKP+ VDI
Sbjct  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
Query  243  INAKQ 247
            IN+++
Sbjct  245  INSRR 249

Sequence Alignment: 12. Allergen Name: Asp t 36.0101 Sequence ID: Q0CJH1

 Score = 206.6 bits 877,  Expect = 6e-55
 Identities = 132/246 53%, Positives = 175/246 71%, Gaps = 2/246 0%
Query  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
            M R+FFVGGN+KMNG   S+  +IK LN AKLD ++EVV   P++YL +AR   +  IGV
Sbjct  1    MPRQFFVGGNFKMNGTADSITSIIKNLNDAKLDSSSEVVISPPALYLLLAREVANSNIGV 60
Query  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
            AAQN +    GAFTGEIS   ++D  + W ++GHSERR ++ E+DE+I +K   A++ G+
Sbjct  61   AAQNVFDKPNGAFTGEISVEQLRDAKIDWTLIGHSERRVILKESDEFIARKVKAAIDGGV 120
Query  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNI--KDWSKVVLAYEPVWAIGTGKTASPA 178
             VI CIGE L+EREAG T  V+  Q    A  +  + W+KVV+AYEPVWAIGTGK A+  
Sbjct  121  SVIFCIGETLEEREAGKTIDVVTRQLNAVAKELSKEQWAKVVIAYEPVWAIGTGKVATTE 180
Query  179  QAQDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPE 238
            QAQ+VH  +R+W+   +S  V+++ RIIYGGSV+   C+EL    DVDGFLVGGA+LKP 
Sbjct  181  QAQEVHAAIRKWLTETISPEVSDNTRIIYGGSVSEKNCRELAKQPDVDGFLVGGASLKPA 240
Query  239  FVDIINAK 246
            FVDIINA+
Sbjct  241  FVDIINAR 248

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.