The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSSPRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNI
GIAAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEA
GMKIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQ
QVQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPD
IVDIINSRRSHVSELLTSLRIEEQQG
Sequence Info Allergen Name Length Opt Bits Score E Value
F8QN77 Pen m 8.0101 266 1765 409.0 9e-116
A0A1L5YRA2 Scy p 8.0101 248 1079 252.6 9.7e-69
F5A6E97 Pro c 8.0101 248 1072 251.0 2.9e-68
Q8T5G9 Arc s 8.0101 224 962 226.0 9.1e-61
XP_026795867 Pan h 8.0101 248 940 220.9 3.4e-59
QAT18637 Der p 25.0101 247 917 215.7 1.3e-57
ACM09737 Sal s 8.01 247 907 213.4 6.1e-57
AIO08860 Der f 25.0201 247 906 213.2 7.2e-57
L7UZA7 Der f 25.0101 247 866 204.1 4e-54
Q0CJH1 Asp t 36.0101 249 797 188.3 2.2e-49
CAC14917 Tri a 31.0101 253 735 174.2 4e-45
CAC14917 Tri a TPIS 253 735 174.2 4e-45
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pen m 8.0101 Sequence ID: F8QN77

 Score = 409.0 bits 1765,  Expect = 9e-116
 Identities = 266/266 100%, Positives = 266/266 100%, Gaps = 0/266 0%
Query  1    MSSPRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNI 60
            MSSPRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNI
Sbjct  1    MSSPRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNI 60
Query  61   GIAAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEA 120
            GIAAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEA
Sbjct  61   GIAAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEA 120
Query  121  GMKIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQ 180
            GMKIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQ
Sbjct  121  GMKIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQ 180
Query  181  QVQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPD 240
            QVQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPD
Sbjct  181  QVQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPD 240
Query  241  IVDIINSRRSHVSELLTSLRIEEQQG 266
            IVDIINSRRSHVSELLTSLRIEEQQG
Sbjct  241  IVDIINSRRSHVSELLTSLRIEEQQG 266

Sequence Alignment: 2. Allergen Name: Scy p 8.0101 Sequence ID: A0A1L5YRA2

 Score = 252.6 bits 1079,  Expect = 1e-68
 Identities = 152/247 61%, Positives = 191/247 77%, Gaps = 1/247 0%
Query  1    MSSPRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNI 60
            M++ RKFFV GNWKMN DK  I+GI+  M    L+A+TE VVGCP CYL Y REH+  NI
Sbjct  1    MANQRKFFVGGNWKMNGDKAAIDGIISFMKGP-LNADTEVVVGCPQCYLMYTREHMPANI 59
Query  61   GIAAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEA 120
            G+AAQNCYK A+G F+GEISP MIKDCGC+WVILGH ERR VF EPD +I+EKV HA EA
Sbjct  60   GVAAQNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVFGEPDQLISEKVGHALEA 119
Query  121  GMKIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQ 180
            G+K+I C+ E  ++R+  RTEEV+F Q+ +L   I+DWSRVV+A+E +WA  TG  AT +
Sbjct  120  GLKVIPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPE 179
Query  181  QVQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPD 240
            Q QD    +R WLR+NVS +VA++TR+IY GSVS+ NC+E+A   ++DGFLVGGASLKPD
Sbjct  180  QAQDVHAKLRQWLRDNVSPQVAESTRIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPD 239
Query  241  IVDIINSR 248
             V IIN+R
Sbjct  240  FVTIINAR 247

Sequence Alignment: 3. Allergen Name: Pro c 8.0101 Sequence ID: F5A6E97

 Score = 251.0 bits 1072,  Expect = 3e-68
 Identities = 151/247 61%, Positives = 191/247 77%, Gaps = 1/247 0%
Query  1    MSSPRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNI 60
            M++ RKFFV GNWKMN D+  I+ I+  M    L A+TE VVGCP CYL Y REHL  NI
Sbjct  1    MANQRKFFVGGNWKMNGDRAGIDSIISFMKGP-LSADTEVVVGCPQCYLMYTREHLPSNI 59
Query  61   GIAAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEA 120
            G+AAQNCYKVA+G F+GEISP MIKDCGC+WVILGH ERR VFNEPD++I+EKV HA EA
Sbjct  60   GVAAQNCYKVAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEA 119
Query  121  GMKIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQ 180
            G+K+I C+ E  ++R+  RTEEV+F Q+ +L   I+DWSRVV+A+E +WA  TG  AT +
Sbjct  120  GLKVIPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPE 179
Query  181  QVQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPD 240
            Q Q+    +R WLR+NV+ +VAD+TR+IY GSV+  NC+E+A   ++DGFLVGGASLKPD
Sbjct  180  QAQEVHAKLRQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGGASLKPD 239
Query  241  IVDIINSR 248
             V IIN+R
Sbjct  240  FVQIINAR 247

Sequence Alignment: 4. Allergen Name: Arc s 8.0101 Sequence ID: Q8T5G9

 Score = 226.0 bits 962,  Expect = 9e-61
 Identities = 133/223 59%, Positives = 170/223 76%, Gaps = 1/223 0%
Query  11   GNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAAQNCYKV 70
            GNWKMN D+  I+ I+  M    L  +TE VVGCP CYL Y REHL  NIG+AAQNCYKV
Sbjct  2    GNWKMNGDRASIDSIISFMKGP-LSGDTEVVVGCPQCYLMYTREHLPSNIGVAAQNCYKV 60
Query  71   ARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKIIACLCE 130
            A+G F+GEISP MIKDCGC+WVILGH ERR VFNEPD++I+EKV HA EAG+K+I C+ E
Sbjct  61   AKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKVIPCIGE 120
Query  131  TTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQDALGLVR 190
              ++R+  RTEEV+F Q+ +L   I+DWSRVV+A+E +WA  TG  AT +Q Q+    +R
Sbjct  121  KLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQEVHAKLR 180
Query  191  NWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGG 234
             WLR+NV+ +VAD+TR+IY GSV+  NC+E+A   ++DGFLVGG
Sbjct  181  QWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGG 224

Sequence Alignment: 5. Allergen Name: Pan h 8.0101 Sequence ID: XP_026795867

 Score = 220.9 bits 940,  Expect = 3e-59
 Identities = 132/244 54%, Positives = 180/244 73%, Gaps = 0/244 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
            RKFFV GNWKMN DK  +  ++  +N+A L+A+TE V G PS YL +AR  L   IG+AA
Sbjct  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
Query  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
            QNCYKVA+G F+GEISP MIKDCG +WVILGH ERR VF E D +I +KVAHA E G+ +
Sbjct  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
Query  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
            IAC+ E  D+R+ G TE+V+F Q  ++A  + DWS+VV+A+E +WA  TG  A+ QQ Q+
Sbjct  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
Query  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
                +R W+  N+S+ VA++ R+IY GSV+   C+E+A+ +++DGFLVGGASLKP+ V+I
Sbjct  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
Query  245  INSR 248
            IN++
Sbjct  244  INAK 247

Sequence Alignment: 6. Allergen Name: Der p 25.0101 Sequence ID: QAT18637

 Score = 215.7 bits 917,  Expect = 1e-57
 Identities = 129/245 52%, Positives = 177/245 72%, Gaps = 0/245 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
            RKFFV GNWKMN  +   + ++K++ N  LD NTE VVG PS YL+  R  L+ +IG+AA
Sbjct  3    RKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVAA 62
Query  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
            QNCYKVA+G F+GEISP MIKD G +WVILGH ERR VF E D +I EKV HA   G+ +
Sbjct  63   QNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLNV 122
Query  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
            IAC+ E  ++R+ G+T EV+F+Q   ++  + DWS+VVLA+E +WA  TG  A+ QQ Q+
Sbjct  123  IACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
Query  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
                +R W+  N+S ++A+T R+IY GSV++ N +E+AS  ++DGFLVGGASLKP+ V I
Sbjct  183  VHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFVQI 242
Query  245  INSRR 249
            +N+R+
Sbjct  243  VNARQ 247

Sequence Alignment: 7. Allergen Name: Sal s 8.01 Sequence ID: ACM09737

 Score = 213.4 bits 907,  Expect = 6e-57
 Identities = 132/245 53%, Positives = 173/245 70%, Gaps = 0/245 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
            RKFFV GNWKMN DK  +  ++K +N+A LD NTE V G PS YL +AR  L   IG+AA
Sbjct  3    RKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGVAA 62
Query  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
            QNCYKV  G F+GEISP MIKD G  WVILGH ERR VF E D +I +K AHA E G+ +
Sbjct  63   QNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGLGV 122
Query  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
            IAC+ E  D+R+ G TE+V+  Q   +A  I DWS+VVLA+E +WA  TG  A+  Q QD
Sbjct  123  IACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQAQD 182
Query  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
                +R W++ NVS+ VA++ R+IY GSV+   C+E+  ++++DGFLVGGA+LKP+ VDI
Sbjct  183  VHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFVDI 242
Query  245  INSRR 249
            IN+++
Sbjct  243  INAKQ 247

Sequence Alignment: 8. Allergen Name: Der f 25.0201 Sequence ID: AIO08860

 Score = 213.2 bits 906,  Expect = 7e-57
 Identities = 127/245 51%, Positives = 176/245 71%, Gaps = 0/245 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
            RKFFV GNWKMN  +     ++K ++N  LD NT+ VVG PS Y++  R+ L   IG+AA
Sbjct  3    RKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAA 62
Query  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
            QNCYKV +G F+GEISP MIKD G +WVILGH ERR VF E D +I EKV HA + G+ +
Sbjct  63   QNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
Query  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
            IAC+ E  ++R+ G+T EV+F+Q   ++  + DWS+VVLA+E +WA  TG  A+ QQ Q+
Sbjct  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
Query  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
                +R W+  NVS ++A+T R+IY GSV+++N +E+AS  ++DGFLVGGASLKP+ V I
Sbjct  183  VHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
Query  245  INSRR 249
            +N+R+
Sbjct  243  VNARQ 247

Sequence Alignment: 9. Allergen Name: Der f 25.0101 Sequence ID: L7UZA7

 Score = 204.1 bits 866,  Expect = 4e-54
 Identities = 127/245 51%, Positives = 172/245 70%, Gaps = 0/245 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
            RKFFV GNWKMN +K  I  IV  + N  LD+N E VVG P+ YL   +  L  NI +AA
Sbjct  3    RKFFVGGNWKMNGNKTAIKEIVDFLKNGPLDSNVEVVVGVPAIYLMLCKNILPDNIRVAA 62
Query  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
            QNCYKV +G F+GEISP MIKD G +WVILGH ERR VF E D +I EKV HA + G+ +
Sbjct  63   QNCYKVDKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
Query  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
            IAC+ E  ++R+ G+T EV+F+Q   ++  + DW +VVLA+E +WA  TG  A+ QQ Q+
Sbjct  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWFKVVLAYEPVWAIGTGKTASPQQAQE 182
Query  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
                +R  +  NVS ++A+T R+IY GSV+++N +E+AS  ++DGFLVGGASLKP+ V I
Sbjct  183  VHQKLRQCFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
Query  245  INSRR 249
            +N+R+
Sbjct  243  VNARQ 247

Sequence Alignment: 10. Allergen Name: Asp t 36.0101 Sequence ID: Q0CJH1

 Score = 188.3 bits 797,  Expect = 2e-49
 Identities = 117/245 47%, Positives = 168/245 68%, Gaps = 2/245 0%
Query  4    PRKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIA 63
            PR+FFV GN+KMN   + I  I+K +N+A LD+++E V+  P+ YL  ARE    NIG+A
Sbjct  2    PRQFFVGGNFKMNGTADSITSIIKNLNDAKLDSSSEVVISPPALYLLLAREVANSNIGVA 61
Query  64   AQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMK 123
            AQN +    G F+GEIS E ++D   DW ++GH ERR ++ E D FIA KV  A + G+ 
Sbjct  62   AQNVFDKPNGAFTGEISVEQLRDAKIDWTLIGHSERRVILKESDEFIARKVKAAIDGGVS 121
Query  124  IIACLCETTDDRQKGRTEEVLFKQLTSLAAAIT--DWSRVVLAFEALWASNTGVFATNQQ 181
            +I C+ ET ++R+ G+T +V+ +QL ++A  ++   W++VV+A+E +WA  TG  AT +Q
Sbjct  122  VIFCIGETLEEREAGKTIDVVTRQLNAVAKELSKEQWAKVVIAYEPVWAIGTGKVATTEQ 181
Query  182  VQDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDI 241
             Q+    +R WL   +S +V+D TR+IY GSVS  NCRE+A   ++DGFLVGGASLKP  
Sbjct  182  AQEVHAAIRKWLTETISPEVSDNTRIIYGGSVSEKNCRELAKQPDVDGFLVGGASLKPAF 241
Query  242  VDIINSR 248
            VDIIN+R
Sbjct  242  VDIINAR 248

Sequence Alignment: 11. Allergen Name: Tri a 31.0101 Sequence ID: CAC14917

 Score = 174.2 bits 735,  Expect = 4e-45
 Identities = 110/243 45%, Positives = 159/243 65%, Gaps = 2/243 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDAN--TEAVVGCPSCYLSYAREHLTHNIGI 62
            RKFFV GNWK N    ++  IV  +N   + +    E VV  P  +L   +  L   I +
Sbjct  3    RKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQV 62
Query  63   AAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGM 122
            AAQNC+    G F+GE+S EM+ + G  WVILGH ERR++  E   F+ EKVA+A   G+
Sbjct  63   AAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQGL 122
Query  123  KIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQV 182
            K+IAC+ ET + R+ G T  V+ +Q  ++A  I DW+ VV+A+E +WA  TG  A+  Q 
Sbjct  123  KVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPAQA 182
Query  183  QDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIV 242
            Q+    +R+WL+ NVS +VA++TR+IY GSV+  +C+E+A+  ++DGFLVGGASLKP+ +
Sbjct  183  QEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPEFI 242
Query  243  DIINS 247
            DIIN+
Sbjct  243  DIINA 247

Sequence Alignment: 12. Allergen Name: Tri a TPIS Sequence ID: CAC14917

 Score = 174.2 bits 735,  Expect = 4e-45
 Identities = 110/243 45%, Positives = 159/243 65%, Gaps = 2/243 0%
Query  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDAN--TEAVVGCPSCYLSYAREHLTHNIGI 62
            RKFFV GNWK N    ++  IV  +N   + +    E VV  P  +L   +  L   I +
Sbjct  3    RKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQV 62
Query  63   AAQNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGM 122
            AAQNC+    G F+GE+S EM+ + G  WVILGH ERR++  E   F+ EKVA+A   G+
Sbjct  63   AAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQGL 122
Query  123  KIIACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQV 182
            K+IAC+ ET + R+ G T  V+ +Q  ++A  I DW+ VV+A+E +WA  TG  A+  Q 
Sbjct  123  KVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPAQA 182
Query  183  QDALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIV 242
            Q+    +R+WL+ NVS +VA++TR+IY GSV+  +C+E+A+  ++DGFLVGGASLKP+ +
Sbjct  183  QEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPEFI 242
Query  243  DIINS 247
            DIIN+
Sbjct  243  DIINA 247

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.