The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL
TNVGSAGPASAAPAGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD
Sequence Info Allergen Name Length Opt Bits Score E Value
AEX34122 Pen cr 26.0101 107 666 145.2 3.7e-37
AAX11194 Pen b 26.0101 107 584 128.3 4.5e-32
P50344 Cla h 12 110 477 106.3 2e-25
P49148 Alt a 12 110 463 103.4 1.5e-24
AAL79930 Fus c 1 109 215 52.3 3.4e-09
Q8H2B9 Pru du 5.0101 113 207 50.6 1.1e-08
P42037 Alt a 6 113 203 49.8 2e-08
AAB48041 Alt a 6 113 202 49.6 2.3e-08
P42039 Cla h 5.0101 111 198 48.8 4e-08
CAA55067 Cla h 5.0101 111 198 48.8 4e-08
Q9UUZ6 Asp f 8 111 197 48.6 4.6e-08
P42039 Cla h 10.0101 111 180 45.1 5.2e-07
AAK00899 Cul n 1 78 137 36.3 0.00016
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pen cr 26.0101 Sequence ID: AEX34122

 Score = 145.2 bits 666,  Expect = 4e-37
 Identities = 107/107 100%, Positives = 107/107 100%, Gaps = 0/107 0%
Query  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
            MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL
Sbjct  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
Query  61   TNVGSAGPASAAPAGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107
            TNVGSAGPASAAPAGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD
Sbjct  61   TNVGSAGPASAAPAGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107

Sequence Alignment: 2. Allergen Name: Pen b 26.0101 Sequence ID: AAX11194

 Score = 128.3 bits 584,  Expect = 4e-32
 Identities = 92/107 85%, Positives = 99/107 92%, Gaps = 0/107 0%
Query  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
            MSTAELA SYAALILADDGIE+SADKIQT++ AA VQEVEPIWA+IFA+ALEGKDIKE+L
Sbjct  1    MSTAELAVSYAALILADDGIEVSADKIQTILGAAKVQEVEPIWATIFAKALEGKDIKEIL 60
Query  61   TNVGSAGPASAAPAGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107
            TNVGSAGPA+A    AAGAAAPAEEK EEKEEEKEESDEDMGFGLFD
Sbjct  61   TNVGSAGPATAGAPAAAGAAAPAEEKKEEKEEEKEESDEDMGFGLFD 107

Sequence Alignment: 3. Allergen Name: Cla h 12 Sequence ID: P50344

 Score = 106.3 bits 477,  Expect = 2e-25
 Identities = 79/107 73%, Positives = 91/107 85%, Gaps = 3/107 2%
Query  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
            MS AELA SYAALILAD+G+EI+ADK+Q LISAA V E+EPIW S+FA+ALEGKD+K+LL
Sbjct  1    MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDLL 60
Query  61   TNVGSAGPASAAPAGAA--GAAAPAEEKAEEK-EEEKEESDEDMGFGLFD 107
             NVGS G A+ A  GAA  GAAA  +  AEEK EEEKEESD+DMGFGLFD
Sbjct  61   LNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110

Sequence Alignment: 4. Allergen Name: Alt a 12 Sequence ID: P49148

 Score = 103.4 bits 463,  Expect = 1e-24
 Identities = 75/105 71%, Positives = 90/105 85%, Gaps = 7/105 6%
Query  1    MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELL 60
            MST+ELA SYAALILADDG++I+ADK+Q+LI AA ++EVEPIW ++FA+ALEGKD+K+LL
Sbjct  1    MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLL 60
Query  61   TNVGSAGPASAAPAGA-----AGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107
             NVGS G A+  P        A  AAPA E  E+KEEEKEESDEDMGFGLFD
Sbjct  61   LNVGSGGGAAPLPEALLLRWRAADAAPAAE--EKKEEEKEESDEDMGFGLFD 110

Sequence Alignment: 5. Allergen Name: Fus c 1 Sequence ID: AAL79930

 Score = 52.3 bits 215,  Expect = 3e-09
 Identities = 47/95 49%, Positives = 61/95 64%, Gaps = 11/95 11%
Query  11   AALILADDG-IEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTNVGS---- 65
            A L+L   G    SA  ++ ++++  +   E     + +  LEGKDI++L+   GS    
Sbjct  6    AYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISE-LEGKDIQQLIAE-GSEKLA 63
Query  66   ---AGPASAAPAGAAGAAAPAEE-KAEEKEEEKEESDEDMGFGLFD 107
               +G A  A  GAA A   AEE K EEKEEEKEESDEDMGFGLFD
Sbjct  64   SVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109

Sequence Alignment: 6. Allergen Name: Pru du 5.0101 Sequence ID: Q8H2B9

 Score = 50.6 bits 207,  Expect = 1e-08
 Identities = 45/84 53%, Positives = 56/84 66%, Gaps = 14/84 16%
Query  14   ILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTNVGSAGPASA-- 71
            IL   G E   D+IQ L+S    +++  + AS       G+   E L +V S G A A  
Sbjct  26   ILGSVGAETDDDRIQLLLSEVKGKDITELIAS-------GR---EKLASVPSGGGAVAVA 75
Query  72   APAGAAGAAAPA--EEKAEEKEEEKEESDEDMGFGLFD 107
            AP   AGAAAPA  E K EEK EEKE++D+DMGF LFD
Sbjct  76   APGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD 113

Sequence Alignment: 7. Allergen Name: Alt a 6 Sequence ID: P42037

 Score = 49.8 bits 203,  Expect = 2e-08
 Identities = 40/87 45%, Positives = 55/87 63%, Gaps = 8/87 9%
Query  14   ILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTNVGSAGPASAAP 73
            +L   GIE  +D++  LIS    +++  + AS       G +    + + G+ G A++  
Sbjct  26   VLESVGIEADSDRLDKLISELEGKDINELIAS-------GSEKLASVPSGGAGGAAASGG 78
Query  74   AGAAGAAAPAEEKAEE-KEEEKEESDEDMGFGLFD 107
            A AAG +A AE   E  KEEEKEESDEDMGFGLFD
Sbjct  79   AAAAGGSAQAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 8. Allergen Name: Alt a 6 Sequence ID: AAB48041

 Score = 49.6 bits 202,  Expect = 2e-08
 Identities = 40/87 45%, Positives = 55/87 63%, Gaps = 8/87 9%
Query  14   ILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTNVGSAGPASAAP 73
            +L   GIE  +D++  LIS    +++  + AS       G +    + + G+ G A++  
Sbjct  26   VLESVGIEADSDRLDKLISELEGKDINELIAS-------GPEKLASVPSGGAGGAAASGG 78
Query  74   AGAAGAAAPAEEKAEE-KEEEKEESDEDMGFGLFD 107
            A AAG +A AE   E  KEEEKEESDEDMGFGLFD
Sbjct  79   AAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 9. Allergen Name: Cla h 5.0101 Sequence ID: P42039

 Score = 48.8 bits 198,  Expect = 4e-08
 Identities = 46/84 54%, Positives = 61/84 72%, Gaps = 10/84 11%
Query  23   SADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTN---------VGSAGPASAAP 73
            SA+ I+T++S+  +   E   +S++ + LEGKDI EL+++          G AG ASA  
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSEKLASVPSGGAGAASAGG 77
Query  74   AGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107
            A AAG AA A  +AE  EEEKEESD+DMGFGLFD
Sbjct  78   AAAAGGAAEAAPEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 10. Allergen Name: Cla h 5.0101 Sequence ID: CAA55067

 Score = 48.8 bits 198,  Expect = 4e-08
 Identities = 46/84 54%, Positives = 61/84 72%, Gaps = 10/84 11%
Query  23   SADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTN---------VGSAGPASAAP 73
            SA+ I+T++S+  +   E   +S++ + LEGKDI EL+++          G AG ASA  
Sbjct  19   SAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSEKLASVPSGGAGAASAGG 77
Query  74   AGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107
            A AAG AA A  +AE  EEEKEESD+DMGFGLFD
Sbjct  78   AAAAGGAAEAAPEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 11. Allergen Name: Asp f 8 Sequence ID: Q9UUZ6

 Score = 48.6 bits 197,  Expect = 5e-08
 Identities = 52/94 55%, Positives = 68/94 72%, Gaps = 15/94 15%
Query  11   AALILADDG-IEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKEL-------LTN 62
            A L+LA  G    S++ ++ ++S+  +   E     + A  LEGKD++EL       L +
Sbjct  6    AFLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAE-LEGKDLQELIAEGSTKLAS 64
Query  63   VGSAGPASAAPA--GAA--GAAAPAEEKAEEKEEEKEESDEDMGFGLFD 107
            V S G A+AAPA  GAA  GAAAPA +  E+ EEEKEESDEDMGFGLFD
Sbjct  65   VPSGGAAAAAPAAAGAAAGGAAAPAAK--EKNEEEKEESDEDMGFGLFD 111

Sequence Alignment: 12. Allergen Name: Cla h 10.0101 Sequence ID: P42039

 Score = 45.1 bits 180,  Expect = 5e-07
 Identities = 50/97 51%, Positives = 65/97 67%, Gaps = 11/97 11%
Query  9    SYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKEL-------LT 61
            +Y  L LA +    SA+ I+T++S+  +   E   +S++ + LEGKDI EL       L 
Sbjct  6    AYLLLGLAGNS-SPSAEDIKTVLSSVGIDADEERLSSLL-KELEGKDINELISSGSQKLA 63
Query  62   NVGSAGPASAAPAGAAGAAAPAEEKAEE--KEEEKEESDEDMGFGLFD 107
            +V S G  +A  AG A AA  A E A E  KEEEKEESD+DMGFGLFD
Sbjct  64   SVPSGGSGAAPSAGGAAAAGGATEAAPEAAKEEEKEESDDDMGFGLFD 111

Sequence Alignment: 13. Allergen Name: Cul n 1 Sequence ID: AAK00899

 Score = 36.3 bits 137,  Expect = 0.0002
 Identities = 26/53 49%, Positives = 34/53 64%, Gaps = 2/53 3%
Query  52   EGKDIKELLTNVGSAGPASAAPAGAAGAAAPAEEKAEEKEEEKEESDEDMGFGLF 106
            E + IKE + +      A+AA A A  A    EEK EEK+EE EESD+D+G+ LF
Sbjct  25   EAETIKEYIKDPSKI--AAAAAATAPAAETKKEEKKEEKKEETEESDDDIGLSLF 77

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.