The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD
GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK
LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD
Sequence Info Allergen Name Length Opt Bits Score E Value
QBF67841 Der f 39.0101 153 975 177.7 1.2e-46
QXY82447 Der p 39.0101 153 967 176.3 3.2e-46
D2DGW3 Tyr p 34.0101 153 936 171.0 1.3e-44
ACL36923 Tyr p 24.0101 153 936 171.0 1.3e-44
Q1M0Y3 Per a 6.0101 151 713 132.8 3.9e-33
ABB89298 Bla g 6.0301 154 712 132.7 4.4e-33
ABB89296 Bla g 6.0101 151 706 131.6 8.9e-33
ABB89297 Bla g 6.0201 151 683 127.7 1.4e-31
P29291 Hom a 6.0101 150 585 110.9 1.5e-26
ADV17344 Pen m 6.0101 150 557 106.1 4.2e-25
Q2KN25 Amb a 10.0101 160 306 63.2 3.8e-12
Q9M7R0 Ole e 8 171 273 57.5 2e-10
AAF31152 Ole e 8 171 271 57.2 2.6e-10
P85100 Bos d 13.0201 199 259 55.2 1.2e-09
P02604 Gal d 7.0101 192 245 52.8 6.3e-09
A0JNJ5 Bos d 13.0101 192 238 51.6 1.4e-08
O82040 Phl p 7 78 177 41.1 8.5e-06
AIO08852 Der f 26.0101 160 181 41.8 1e-05
P94092 Cyn d 7 80 171 40.0 1.8e-05
CAA62634 Cyn d 7 82 171 40.0 1.8e-05
J7HCX7 Pro c 5.0101 153 175 40.8 2e-05
CAP05019 Par j 4.0101 84 168 39.5 2.6e-05
A0A514C9K9 Scy p 3.0101 153 171 40.1 3.3e-05
ALE34025 Sal k 7.0101 86 166 39.2 3.4e-05
P58171 Syr v 3 81 165 39.0 3.6e-05
AAL92871 Che a 3 86 165 39.0 3.9e-05
O81092 Ole e 3 84 162 38.5 5.4e-05
O81701 Aln g 4 85 161 38.3 6.1e-05
P69197 Bra r 5.0101 79 159 38.0 7.2e-05
CAA73147 Bet v 4 85 158 37.8 8.7e-05
Q39419 Bet v 4 85 158 37.8 8.7e-05
ABP87672 Cup a 4.0101 177 162 38.5 0.00011
P43187 Bet v 3 205 162 38.6 0.00013
O64943 Jun o 4 165 156 37.5 0.00021
A7L499 Art fr 5.0101 144 140 34.8 0.0012
XP_019400389 Cro p 2.0101 110 127 32.5 0.0044
Q91483 Sal s 1 107 126 32.4 0.0049
CAA66404 Sal s 1 108 126 32.4 0.0049
CAC83046 Ran e 1 110 126 32.4 0.005
C1L370 Gal d 8.0101 110 126 32.4 0.005
XP_026772003 Pan h 1.0101 109 122 31.7 0.0079
CAQ72968 Seb m 1.0101 109 121 31.5 0.0089
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 177.7 bits 975,  Expect = 1e-46
 Identities = 153/153 100%, Positives = 153/153 100%, Gaps = 0/153 0%
Query  1    MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD 60
            MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD
Sbjct  1    MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD 60
Query  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
            GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK
Sbjct  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  121  LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD
Sbjct  121  LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153

Sequence Alignment: 2. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 176.3 bits 967,  Expect = 3e-46
 Identities = 152/153 99%, Positives = 152/153 99%, Gaps = 0/153 0%
Query  1    MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD 60
            MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQ LITEIDAD
Sbjct  1    MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDAD 60
Query  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
            GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK
Sbjct  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  121  LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD
Sbjct  121  LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153

Sequence Alignment: 3. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 171.0 bits 936,  Expect = 1e-44
 Identities = 146/153 95%, Positives = 149/153 97%, Gaps = 0/153 0%
Query  1    MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD 60
            MSVEEL+KEQVQMLRKAFDMFDR+KKG+IHTNMVSTILRTLGQTFEE DLQQLI EIDAD
Sbjct  1    MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDAD 60
Query  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
            GSGELEFDEFLTLTARFLVEED EAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK
Sbjct  61   GSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  121  LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            LT DELDEMIAEIDTDGSGTVDFDEFMEMMTGD
Sbjct  121  LTEDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153

Sequence Alignment: 4. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 171.0 bits 936,  Expect = 1e-44
 Identities = 146/153 95%, Positives = 149/153 97%, Gaps = 0/153 0%
Query  1    MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD 60
            MSVEEL+KEQVQMLRKAFDMFDR+KKG+IHTNMVSTILRTLGQTFEE DLQQLI EIDAD
Sbjct  1    MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDAD 60
Query  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
            GSGELEFDEFLTLTARFLVEED EAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK
Sbjct  61   GSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  121  LTNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            LT DELDEMIAEIDTDGSGTVDFDEFMEMMTGD
Sbjct  121  LTEDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153

Sequence Alignment: 5. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 132.8 bits 713,  Expect = 4e-33
 Identities = 106/151 70%, Positives = 131/151 86%, Gaps = 0/151 0%
Query  3    VEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGS 62
            ++EL  EQ+Q+L+KAFD FDREK G I T+MV TIL  LG+ +++  L+++I E+DADGS
Sbjct  1    MDELPDEQIQLLKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEEIIAEVDADGS 60
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
            GELEF EF+TL ARFLVEEDAEAMQ+EL+EAFR+YDKEGNGYI T+ LREIL+ LDDKLT
Sbjct  61   GELEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLT 120
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            N++LD MI EID+DGSGTVDFDEFME+MTG+
Sbjct  121  NEDLDAMIEEIDSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 6. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 132.7 bits 712,  Expect = 4e-33
 Identities = 106/148 71%, Positives = 125/148 84%, Gaps = 0/148 0%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
            +L  EQ+ +LRKAFD FDREK G I TNMV  ILR +GQ F  + L++LI E+DAD SG 
Sbjct  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
Query  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
            LEFDEF+TL A+F++EED+EAM++ELREAFR+YDKEGNGYIPTS LREILR LD++LT+D
Sbjct  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
Query  125  ELDEMIAEIDTDGSGTVDFDEFMEMMTG 152
            ELD MI EID DGSGTVDFDEFMEMMTG
Sbjct  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154

Sequence Alignment: 7. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 131.6 bits 706,  Expect = 9e-33
 Identities = 105/151 69%, Positives = 131/151 86%, Gaps = 0/151 0%
Query  3    VEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGS 62
            ++EL  EQ+Q+L+KAFD FDREKKG I T MV TIL  LG+ +++  LQ++I E+DADGS
Sbjct  1    MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGS 60
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
            GELEF+EF++L +RFLVEEDAEAMQ+ELREAFR+YDKEGNGYI T+ LREIL+ LDDK+T
Sbjct  61   GELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKIT 120
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
             ++LD MI EID+DGSGTVDFDEFME+MTG+
Sbjct  121  AEDLDMMIEEIDSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 8. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 127.7 bits 683,  Expect = 1e-31
 Identities = 104/151 68%, Positives = 126/151 83%, Gaps = 0/151 0%
Query  3    VEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGS 62
            ++E+  EQV +L+KAFD FDREKKG I T MV TIL  LG  +++  L ++I E+DADGS
Sbjct  1    MDEIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGS 60
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
            GELEF+EF TL +RFLVEEDAEAMQ ELREAFR+YDKEGNGYI T+ LREIL+ LDDK+T
Sbjct  61   GELEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKIT 120
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
             ++LD MI EID+DGSGTVDFDEFME+MTG+
Sbjct  121  AEDLDMMIEEIDSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 9. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 110.9 bits 585,  Expect = 2e-26
 Identities = 86/150 57%, Positives = 114/150 76%, Gaps = 0/150 0%
Query  3    VEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGS 62
            ++ L  EQ+  L+KAFD FD + KG I    V  ILR +G    EK+LQ++I+E D DGS
Sbjct  1    MDSLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGS 60
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
            GELEF+EF+ L A+FL+EED EA++ ELREAFR+YD+ GNGYI T  L+EILR LD++LT
Sbjct  61   GELEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLT 120
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMMTG 152
             ++LD +I E+D DGSGT+DF+EFM+MM G
Sbjct  121  EEDLDSIIEEVDEDGSGTLDFNEFMQMMNG 150

Sequence Alignment: 10. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 106.1 bits 557,  Expect = 4e-25
 Identities = 85/150 56%, Positives = 110/150 73%, Gaps = 0/150 0%
Query  3    VEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGS 62
            ++ L +EQ++ LRKAF+ FD E  G I+   V  ILR +G    EK+LQ++I E D DGS
Sbjct  1    MDSLDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGS 60
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
            G LEF+EF  L A+FL+EED EA++ ELREAFR+YDK+  GYI T  L+EIL  LD KLT
Sbjct  61   GMLEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLT 120
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMMTG 152
              +L+ +I E+D DGSGT+DFDEFMEMM+G
Sbjct  121  PTDLEGIIEEVDEDGSGTLDFDEFMEMMSG 150

Sequence Alignment: 11. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 63.2 bits 306,  Expect = 4e-12
 Identities = 51/144 35%, Positives = 88/144 61%, Gaps = 6/144 4%
Query  2    SVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADG 61
            S+    KE+V    K F+ FD    G+I  + +  IL++LG      ++++++ EIDADG
Sbjct  9    SIFPTDKEEV---TKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADG 65
Query  62   SGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKL 121
             G + +DEF+ +     +E + + + + L+EAF+ YD+  NG I  + L +IL  L +  
Sbjct  66   DGFISLDEFILFCKG--IESEGDEIND-LKEAFKFYDQNNNGVISANELHQILGRLGENY 122
Query  122  TNDELDEMIAEIDTDGSGTVDFDEFMEMMT 151
            + +   +MI  +D+DG G VDF+EF +MM+
Sbjct  123  SVESCADMIKSVDSDGDGFVDFEEFRKMMS 152

Sequence Alignment: 12. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 57.5 bits 273,  Expect = 2e-10
 Identities = 43/134 32%, Positives = 73/134 54%, Gaps = 0/134 0%
Query  18   FDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGELEFDEFLTLTARF 77
            F+ FD    G I  + ++ +L+ LG    ++++ +++ EID D  G +   EF  +    
Sbjct  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAE 84
Query  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++    +  EMI  +D+DG
Sbjct  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
Query  138  SGTVDFDEFMEMMT 151
             G V F+EF +MMT
Sbjct  145  DGYVSFEEFKKMMT 158

Sequence Alignment: 13. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 57.2 bits 271,  Expect = 3e-10
 Identities = 43/134 32%, Positives = 72/134 53%, Gaps = 0/134 0%
Query  18   FDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGELEFDEFLTLTARF 77
            F+ FD    G I  + ++  L+ LG    ++++ +++ EID D  G +   EF  +    
Sbjct  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAE 84
Query  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++    +  EMI  +D+DG
Sbjct  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
Query  138  SGTVDFDEFMEMMT 151
             G V F+EF +MMT
Sbjct  145  DGYVSFEEFKKMMT 158

Sequence Alignment: 14. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 55.2 bits 259,  Expect = 1e-09
 Identities = 45/146 30%, Positives = 88/146 60%, Gaps = 7/146 4%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNM--VSTILRTLGQTFEEKDLQQLITEIDAD-- 60
            E+T EQ++ +++AF +FDR  K  +         +LR LGQ   + ++ +++ +   +  
Sbjct  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
Query  61   GSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK 120
             S  ++FD FL +       +D     E++ E +R++DKEGNG +  + LR +L  L +K
Sbjct  109  NSKMMDFDTFLPMLQHISKNKDT-GTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 167
Query  121  LTNDELDEMIAEIDTDGSGTVDFDEFME-MMTG 152
            LT DE+++++A    D +G ++++ F++ +M G
Sbjct  168  LTEDEVEKLMAG-QEDSNGCINYEAFVKHIMAG 199

Sequence Alignment: 15. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 52.8 bits 245,  Expect = 6e-09
 Identities = 41/144 28%, Positives = 86/144 59%, Gaps = 4/144 2%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD--GS 62
            E++KEQ   +++AF +FDR     I  + V  I+R LGQ     ++ +++     +   +
Sbjct  44   EFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNA 103
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
             ++ F+EFL +       +D +   E++ E +R++DKEGNG +  + LR +L  L +K+T
Sbjct  104  KKITFEEFLPMLQAAANNKD-QGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMT 162
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMM 150
             +E++E++ +   D +G ++++ F++ +
Sbjct  163  EEEVEELM-KGQEDSNGCINYEAFVKHI 189

Sequence Alignment: 16. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 51.6 bits 238,  Expect = 1e-08
 Identities = 38/147 25%, Positives = 88/147 59%, Gaps = 4/147 2%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDAD--GS 62
            E++K+Q   +++AF +FDR  +  I  + V  +LR LG      ++++++     +   +
Sbjct  44   EFSKQQQDEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNA 103
Query  63   GELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLT 122
             ++EF++FL +       +D +   E++ E +R++DKEGNG +  + LR +L  L +K+ 
Sbjct  104  KKIEFEQFLPMLQAISNNKD-QGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMK 162
Query  123  NDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
             +E++ ++A  + D +G ++++ F++ +  +
Sbjct  163  EEEVEALMAGQE-DSNGCINYEAFVKHIMSN 192

Sequence Alignment: 17. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 41.1 bits 177,  Expect = 8e-06
 Identities = 26/61 42%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  86   MQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDE 145
            M +++   F+ +D  G+G I  S L + LR L    + DE+  M+AEIDTDG G +DF+E
Sbjct  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
Query  146  FM 147
            F+
Sbjct  60   FI 61

Sequence Alignment: 18. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 41.8 bits 181,  Expect = 1e-05
 Identities = 39/146 26%, Positives = 80/146 54%, Gaps = 5/146 3%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
            +L   +V+  R  FD++D + +  +  + +  +LR+L     +  + +   E    G   
Sbjct  3    DLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQKF 61
Query  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
            + F+EFL + ++   ++D  A  E+L E +++YDK  NG +  + L  +L +L +KLT+ 
Sbjct  62   MTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
Query  125  ELDEMIAEID--TDGSGTVDFDEFME-MMTG 152
            E++E+I       D  G + ++ F++ +M G
Sbjct  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151

Sequence Alignment: 19. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 40.0 bits 171,  Expect = 2e-05
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFM 147
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63

Sequence Alignment: 20. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 40.0 bits 171,  Expect = 2e-05
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFM 147
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65

Sequence Alignment: 21. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 40.8 bits 175,  Expect = 2e-05
 Identities = 39/139 28%, Positives = 80/139 57%, Gaps = 16/139 11%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
            +L+   V+ ++ AF ++D E  G +    +   LR L       +L   +  I+  G  E
Sbjct  4    DLSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRAL-------NLNPTLAIIEKVGGKE 56
Query  65   ------LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALD 118
                  ++++EF+ + A+   ++DA +  E++ E +++YDK  NG +  + L  IL +L 
Sbjct  57   KRKEKIIKLEEFIPIFAQVKKDKDAGSY-EDFMEVLKLYDKSENGTMMYAELEHILLSLG 115
Query  119  DKLTNDELDEMIAEI--DTDGSGTVDFDEFMEMMT 151
            ++L   EL+ ++ E   + D  G + ++ F++ MT
Sbjct  116  ERLEKSELEPVLKECCNEEDEDGFIPYEPFLKKMT 150

Sequence Alignment: 22. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 39.5 bits 168,  Expect = 3e-05
 Identities = 27/64 42%, Positives = 40/64 62%, Gaps = 1/64 1%
Query  82   DAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTV 141
            D +  + E    F+ +D  G+G I +S L E L+AL   +T DE+  M+AEIDTDG G +
Sbjct  3    DKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALGS-VTADEVHRMMAEIDTDGDGAI 61
Query  142  DFDEF 146
             ++EF
Sbjct  62   SLEEF 66

Sequence Alignment: 23. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 40.1 bits 171,  Expect = 3e-05
 Identities = 37/145 25%, Positives = 77/145 53%, Gaps = 4/145 2%
Query  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
            +L+   V+  + AF ++D E KG +    V   LR L        ++++  +        
Sbjct  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-M 62
Query  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
            L+ D+FL + A+   ++DA +  E++ E +++YDK  NG +  + L  IL +L ++L   
Sbjct  63   LKVDDFLPIFAQVKKDKDAGSF-EDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
Query  125  ELDEMIAEI--DTDGSGTVDFDEFMEMMT 151
            EL+ ++ +   + D  G + ++ F++ +T
Sbjct  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150

Sequence Alignment: 24. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 39.2 bits 166,  Expect = 3e-05
 Identities = 27/70 38%, Positives = 41/70 58%, Gaps = 1/70 1%
Query  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
            +  ED      +    F+ +D  G+G I +S L + L+ L   +T+DE+  M+AEIDTDG
Sbjct  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
Query  138  SGTVDFDEFME 148
             G + F+EF E
Sbjct  60   DGFISFEEFTE 70

Sequence Alignment: 25. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 39.0 bits 165,  Expect = 4e-05
 Identities = 26/57 45%, Positives = 37/57 64%, Gaps = 1/57 1%
Query  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEF 146
            EL   F+ +D  G+G I +S L E L+ L   +T +E+  M+AEIDTDG G + F+EF
Sbjct  7    ELERIFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEF 63

Sequence Alignment: 26. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 39.0 bits 165,  Expect = 4e-05
 Identities = 27/70 38%, Positives = 40/70 57%, Gaps = 1/70 1%
Query  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
            +  ED      +    F+ +D  G+G I +S L + L+ L   +T DE+  M+AEIDTDG
Sbjct  1    MAAEDTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTPDEVRRMMAEIDTDG 59
Query  138  SGTVDFDEFME 148
             G + FDEF +
Sbjct  60   DGFISFDEFTD 70

Sequence Alignment: 27. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 38.5 bits 162,  Expect = 5e-05
 Identities = 27/64 42%, Positives = 41/64 64%, Gaps = 2/64 3%
Query  81   EDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGT 140
            +D + + E  R  F+ +D  G+G I +S L E L+ L   +T +E+  M+AEIDTDG G 
Sbjct  3    DDPQEVAEHER-IFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGF 60
Query  141  VDFDEF 146
            + F+EF
Sbjct  61   ISFEEF 66

Sequence Alignment: 28. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 38.3 bits 161,  Expect = 6e-05
 Identities = 27/65 41%, Positives = 37/65 56%, Gaps = 1/65 1%
Query  81   EDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGT 140
            +D    Q E    F+ +D  G+G I  S L + L+ L   +T DE+  M+AEIDTDG G 
Sbjct  3    DDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGS-VTPDEVKHMMAEIDTDGDGF 61
Query  141  VDFDEF 146
            + F EF
Sbjct  62   ISFQEF 67

Sequence Alignment: 29. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 38.0 bits 159,  Expect = 7e-05
 Identities = 26/67 38%, Positives = 43/67 64%, Gaps = 4/67 5%
Query  83   AEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVD 142
            A+A +E +   F+ +D +G+G I  + L E L+ L   +T D++  M+A+IDTDG G + 
Sbjct  2    ADAEHERI---FKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNIS 57
Query  143  FDEFMEMMTGD 153
            F EF E  + +
Sbjct  58   FQEFTEFASAN 68

Sequence Alignment: 30. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 37.8 bits 158,  Expect = 9e-05
 Identities = 26/67 38%, Positives = 38/67 56%, Gaps = 1/67 1%
Query  81   EDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGT 140
            +D    + E    F+ +D  G+G I  + L E L+ L   +T DE+  M+AEIDTDG G 
Sbjct  3    DDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGS-ITPDEVKHMMAEIDTDGDGF 61
Query  141  VDFDEFME 148
            + F EF +
Sbjct  62   ISFQEFTD 69

Sequence Alignment: 31. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 37.8 bits 158,  Expect = 9e-05
 Identities = 26/67 38%, Positives = 38/67 56%, Gaps = 1/67 1%
Query  81   EDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGT 140
            +D    + E    F+ +D  G+G I  + L E L+ L   +T DE+  M+AEIDTDG G 
Sbjct  3    DDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGS-ITPDEVKHMMAEIDTDGDGF 61
Query  141  VDFDEFME 148
            + F EF +
Sbjct  62   ISFQEFTD 69

Sequence Alignment: 32. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 38.5 bits 162,  Expect = 0.0001
 Identities = 42/145 28%, Positives = 84/145 57%, Gaps = 7/145 4%
Query  2    SVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADG 61
            S + + ++ V+ L + F  FD    G I  + ++ ILR++G   +E +++ ++ E D DG
Sbjct  27   SGKRVLEQSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDG 86
Query  62   SGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKL 121
             G + + EF+ L  +        A  ++L+ AF+++D++ NG I  + L + L+++ +  
Sbjct  87   DGYVSLQEFVDLNIK-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPC 139
Query  122  TNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            T +E   +I  +D +G G +  +EF  MMT +
Sbjct  140  TIEESKNIIHNVDKNGDGLISVEEFQTMMTSE 171

Sequence Alignment: 33. Allergen Name: Bet v 3 Sequence ID: P43187

 Score = 38.6 bits 162,  Expect = 0.0001
 Identities = 44/137 32%, Positives = 83/137 60%, Gaps = 20/137 14%
Query  14   LRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGELEFDEFLTL 73
            LR+ FD+FD+   G I  + +S  L  LG   +  +L+  +     +G+  L+F++F++L
Sbjct  41   LRRIFDLFDKNSDGIITVDELSRALNLLGLETDLSELESTVKSFTREGNIGLQFEDFISL 100
Query  74   -----TARFLVE-EDAEAMQEELREA------------FRMYDKEGNGYIPTSALREILR 115
                  + F    ED +  +E++R++            F+++D++G+GYI    L+ +L 
Sbjct  101  HQSLNDSYFAYGGEDEDDNEEDMRKSILSQEEADSFGGFKVFDEDGDGYISARELQMVLG 160
Query  116  AL--DDKLTNDELDEMIAEIDTDGSGTVDFDEFMEMM 150
             L   +    D +++MI  +D++  G VDF EF +MM
Sbjct  161  KLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKDMM 197

Sequence Alignment: 34. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 37.5 bits 156,  Expect = 0.0002
 Identities = 45/145 31%, Positives = 82/145 56%, Gaps = 7/145 4%
Query  2    SVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADG 61
            S E + ++ V+ L + F  FD    G I  + ++ ILR+LG    E +++ ++ E DADG
Sbjct  15   SGEVVMEQSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADG 74
Query  62   SGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKL 121
             G + + EF+ L  +        A  ++L+ AF+++D++ NG I  + L   L ++ +  
Sbjct  75   DGYVSLQEFVDLNNK-------GASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPC 127
Query  122  TNDELDEMIAEIDTDGSGTVDFDEFMEMMTGD 153
            T +E   +I  +D +G G +  +EF  MMT +
Sbjct  128  TIEESKNIIHNVDKNGDGLISVEEFQTMMTSE 159

Sequence Alignment: 35. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 34.8 bits 140,  Expect = 0.001
 Identities = 32/111 28%, Positives = 63/111 56%, Gaps = 10/111 9%
Query  41   LGQTFEEKDLQQLITEIDADGSGE------LEFDEFLTLTARFLVEEDAEAMQEELREAF 94
            LG  +   +L   + +I+  G  +      L+ +EFL + ++   E+D   + E++ E  
Sbjct  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTL-EDFIECM 77
Query  95   RMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAE-IDT-DGSGTVDFDEFME-MMT 151
            ++YDK  NG +  + L  IL AL +KL + ++D +  E +D  D  G + +  F++ ++ 
Sbjct  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
Query  152  G 152
            G
Sbjct  138  G 138

Sequence Alignment: 36. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 32.5 bits 127,  Expect = 0.004
 Identities = 20/64 31%, Positives = 41/64 64%, Gaps = 3/64 4%
Query  87   QEELREAFRMYDKEGNGYIPTSALREILRAL--DDK-LTNDELDEMIAEIDTDGSGTVDF 143
            Q+++++ F + DK+ +G+I    L+ +L+ +  D + L++ E  E++A  D DG G +  
Sbjct  41   QDDVKKVFHILDKDRSGFIEEDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGV 100
Query  144  DEFMEMM 150
            DEF  ++
Sbjct  101  DEFTSLV 107

Sequence Alignment: 37. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 32.4 bits 126,  Expect = 0.005
 Identities = 21/70 30%, Positives = 39/70 55%, Gaps = 3/70 4%
Query  83   AEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK---LTNDELDEMIAEIDTDGSG 139
            A    +++++AF + D++ +G+I    L+  L+ +      LT+ E    +A+ D DG G
Sbjct  35   ASKSSDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKAFLADGDKDGDG 94
Query  140  TVDFDEFMEMMTG 152
             +  DEF  M+ G
Sbjct  95   MIGVDEFAAMIKG 107

Sequence Alignment: 38. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 32.4 bits 126,  Expect = 0.005
 Identities = 21/70 30%, Positives = 39/70 55%, Gaps = 3/70 4%
Query  83   AEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDK---LTNDELDEMIAEIDTDGSG 139
            A    +++++AF + D++ +G+I    L+  L+ +      LT+ E    +A+ D DG G
Sbjct  36   ASKSSDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKAFLADGDKDGDG 95
Query  140  TVDFDEFMEMMTG 152
             +  DEF  M+ G
Sbjct  96   MIGVDEFAAMIKG 108

Sequence Alignment: 39. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 32.4 bits 126,  Expect = 0.005
 Identities = 20/70 28%, Positives = 43/70 61%, Gaps = 3/70 4%
Query  6    LTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTL---GQTFEEKDLQQLITEIDADGS 62
            L  +  ++++K F ++D+++ G I    +  IL+ +   G+++ +K+   L+   D DG 
Sbjct  36   LKSKSKEIMQKVFHVLDQDQSGFIEKEELCLILKGFTPEGRSLSDKETTALLAAGDKDGD 95
Query  63   GELEFDEFLTLTA 75
            G++  DEF+TL +
Sbjct  96   GKIGVDEFVTLVS 108

Sequence Alignment: 40. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 32.4 bits 126,  Expect = 0.005
 Identities = 20/70 28%, Positives = 42/70 60%, Gaps = 3/70 4%
Query  6    LTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTL---GQTFEEKDLQQLITEIDADGS 62
            L K+  + ++K F ++D+++ G I    +  +L+ +   G+ + +K+ + L+   D DG 
Sbjct  36   LKKKSPEDVKKVFHILDKDRSGFIEEEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGD 95
Query  63   GELEFDEFLTLTA 75
            G++  DEF T+ A
Sbjct  96   GKIGADEFATMVA 108

Sequence Alignment: 41. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 31.7 bits 122,  Expect = 0.008
 Identities = 29/98 29%, Positives = 55/98 56%, Gaps = 11/98 11%
Query  45   FEEKDLQQLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGY 104
            + + D+   +    ADGS    FD    +T   L  + A+    ++++AF + D++ +G+
Sbjct  7    LNDADIAAALDACKADGS----FDHKAFFTKVGLTGKSAD----DVKKAFSIIDQDKSGF 58
Query  105  IPTSALREILRAL--DDK-LTNDELDEMIAEIDTDGSGTVDFDEFMEMM 150
            I    L+  L+ +  D + LT++E    +   DTDG G +  DEF  ++
Sbjct  59   IEEDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLV 107

Sequence Alignment: 42. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 31.5 bits 121,  Expect = 0.009
 Identities = 20/65 30%, Positives = 36/65 55%, Gaps = 3/65 4%
Query  88   EELREAFRMYDKEGNGYIPTSALREILR---ALDDKLTNDELDEMIAEIDTDGSGTVDFD 144
            ++++ AF++ D++ +G+I    L+  L+   A    LT  E    +   D+DG G +  D
Sbjct  42   DDIKNAFKVIDQDKSGFIEEEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMD 101
Query  145  EFMEMMTG 152
            EF  M+ G
Sbjct  102  EFAAMVKG 109

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.