The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL
APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE
RLGDYLIDQGYYVGSHHHHHH
Sequence Info Allergen Name Length Opt Bits Score E Value
P49233 Tri a 12.0102 141 996 252.0 4.4e-69
P49234 Tri a 12.0103 140 940 238.3 6e-65
P49232 Tri a 12.0101 138 910 230.9 9.6e-63
FM164277 Tri a 12.0104 131 897 227.8 8e-62
P52184 Hor v 12.0101 131 864 219.7 2.2e-59
Q9FR39 Zea m 12.0105 131 803 204.7 7.2e-55
AAK54835 Ana c 1 131 798 203.5 1.7e-54
O22655 Zea m 12.0104 131 797 203.2 2e-54
AAL07320 Lit c 1 131 772 197.1 1.4e-52
O24650 Phl p 12.0102 131 769 196.3 2.4e-52
CAA54686 Phl p 12.0101 131 766 195.6 3.9e-52
AAP13533 Cuc m 2 131 766 195.6 3.9e-52
P35079 Phl p 12.0101 131 766 195.6 3.9e-52
O04725 Cyn d 12 131 765 195.4 4.6e-52
P35081 Zea m 12.0101 131 764 195.1 5.5e-52
Q9M7N0 Hev b 8.0201 131 762 194.6 7.7e-52
A0A2I4DNN6 Jug r 7.0101 131 761 194.4 9.2e-52
AF377948 Mus a 1.0101 131 761 194.4 9.2e-52
Q9STB6 Hev b 8.0102 131 759 193.9 1.3e-51
O65809 Gly m 3 131 757 193.4 1.8e-51
Q9FUD1 Ory s 12.0101 131 755 192.9 2.5e-51
Q9XF38 Pyr c 4 131 755 192.9 2.5e-51
Q5XWE1 Citr l 2.0101 131 754 192.7 3e-51
O65810 Gly m 3 131 754 192.7 3e-51
AAL76933 Dau c 4 134 754 192.6 3.1e-51
Q9XF41 Mal d 4 131 753 192.4 3.6e-51
Q9XF37 Api g 4 134 753 192.4 3.7e-51
Q9XF40 Mal d 4 131 751 191.9 5e-51
O24282 Phl p 12.0103 131 750 191.7 6e-51
P35083 Zea m 12.0103 131 749 191.4 7.1e-51
CAD37202 Pru p 4.0201 131 748 191.2 8.4e-51
Q9LEI8 Hev b 8.0204 131 748 191.2 8.4e-51
Q9XF42 Mal d 4 131 745 190.5 1.4e-50
P35082 Zea m 12.0102 131 743 190.0 2e-50
ACP43298 Ama r 2.0101 133 742 189.7 2.4e-50
Q9M7M8 Hev b 8.0203 131 741 189.5 2.8e-50
Q8L5D8 Pho d 2.0101 131 740 189.2 3.3e-50
AAL92870 Che a 2 131 740 189.2 3.3e-50
QID21357 Pop n 2.0101 131 738 188.7 4.6e-50
CAD37201 Pru p 4.0101 131 737 188.5 5.5e-50
QVU02258 Que ac 2.0101 133 735 188.0 7.9e-50
O49894 Mer a 1 133 735 188.0 7.9e-50
Q9AXH4 Cor a 2 131 733 187.5 1.1e-49
XP030492464 Can s 2.0101 133 732 187.2 1.3e-49
AAL29690 Lyc e 1 131 731 187.0 1.5e-49
AY081850 Pru du 4.0101 131 731 187.0 1.5e-49
AY081852 Pru du 4.0102 131 731 187.0 1.5e-49
Q9XF39 Pru av 4 131 730 186.8 1.8e-49
Q9M7M9 Hev b 8.0202 131 727 186.0 3e-49
P25816 Bet v 2 133 727 186.0 3.1e-49
Q5EF31 Cro s 1.0101 131 726 185.8 3.6e-49
O24169 Ole e 2 134 724 185.3 5.2e-49
O24170 Ole e 2 134 722 184.8 7.3e-49
AAK01235 Cor a 2 131 717 183.6 1.6e-48
CAD10376 Cap a 2 131 717 183.6 1.6e-48
Q93YG7 Sola l 1.0101 131 717 183.6 1.6e-48
CAD10377 Lyc e 1 131 717 183.6 1.6e-48
O24171 Ole e 2 134 717 183.6 1.7e-48
ABU95412 Sin a 4.0101 131 714 182.8 2.7e-48
P84177 Cit s 2.0101 131 714 182.8 2.7e-48
Q9SQI9 Ara h 5 131 714 182.8 2.7e-48
Q9XG85 Par j 3 132 713 182.6 3.3e-48
A0A0A0REA1 Koc s 2.0101 133 711 182.1 4.7e-48
A0A023W2L7 Pro j 2.0101 133 711 182.1 4.7e-48
Q9T0M8 Par j 3 131 702 179.9 2.1e-47
O65812 Hev b 8.0101 131 702 179.9 2.1e-47
Q42449 Ara t 8 131 702 179.9 2.1e-47
O81982 Hel a 2 133 702 179.9 2.2e-47
A0A0A0RCW1 Aca f 2 133 700 179.4 3.1e-47
ACS34771 Sal k 4.0101 133 700 179.4 3.1e-47
AJ421030 Art v 4.0101 133 696 178.4 6e-47
AJ421031 Art v 4.0201 133 687 176.2 2.8e-46
QRN65366 Lig v 2.0101 134 687 176.2 2.8e-46
ADK22841 Sal k 4.0201 133 668 171.5 7.1e-45
FG438715 Act d 9.0101 109 588 152.1 4.1e-39
QEQ43417 Sola m 1.0101 159 531 137.7 1.3e-34
A0A1B2YLJ4 Tyr p 36.0101 131 271 74.0 1.6e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 252.0 bits 996,  Expect = 4e-69
 Identities = 141/141 100%, Positives = 141/141 100%, Gaps = 0/141 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGYYVGSHHHHHH 141
            RLGDYLIDQGYYVGSHHHHHH
Sbjct  121  RLGDYLIDQGYYVGSHHHHHH 141

Sequence Alignment: 2. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 238.3 bits 940,  Expect = 6e-65
 Identities = 134/140 95%, Positives = 138/140 98%, Gaps = 1/140 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSW+AYVDDHLCCEIDGQ+LTSAAILGHDGSVWA+SPNFP+FKPEE AGIVKDFEEPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGYYVGSHHHHHH 141
            RLGDYLIDQGY  GSHHHHHH
Sbjct  121  RLGDYLIDQGY-CGSHHHHHH 140

Sequence Alignment: 3. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 230.9 bits 910,  Expect = 1e-62
 Identities = 131/135 97%, Positives = 132/135 97%, Gaps = 0/135 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHLCCEIDGQHLTSAAILGHDGSVW ESPNFPKFKPEEIAGIVKDFEEPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGYYVGS 135
            RLGDYLIDQGY+V S
Sbjct  121  RLGDYLIDQGYWVPS 135

Sequence Alignment: 4. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 227.8 bits 897,  Expect = 8e-62
 Identities = 128/131 97%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSW+AYVDDHLCCEIDGQHLTSAAILGHDGSVWA+SPNFP+FKPEEIAGIVKDFEEPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 5. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 219.7 bits 864,  Expect = 2e-59
 Identities = 120/131 91%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHLCCEIDGQHLTSAAILGHDG VW +SPNFP+FKPEEIAGI+KDF+EPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 6. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 204.7 bits 803,  Expect = 7e-55
 Identities = 110/131 83%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+I+GQHL++AAI+GHDGSVWA+S NFP++KPEE+AG++KDF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM+LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 7. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 203.5 bits 798,  Expect = 2e-54
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL CEIDGQHL+SAAILGHD +VWA+SPNFP+FKPEEI+ I+ DFE PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT +ALI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 8. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 203.2 bits 797,  Expect = 2e-54
 Identities = 109/131 83%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVD+HL CEI+GQHL++AAI+GHDGSVWA+S +FP++KPEE+AGI+KDF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM+LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 9. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 197.1 bits 772,  Expect = 1e-52
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL CE DGQHLT+AAI+GHDGSVWA+S NFP+FKP EIA I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLVDQG 130

Sequence Alignment: 10. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 196.3 bits 769,  Expect = 2e-52
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HL SAAILGHDG+VWA+S +FP+FKPEEI GI+KDF+EPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 11. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 195.6 bits 766,  Expect = 4e-52
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HL SAAILGHDG+VWA+S +FP+FKPEEI GI+KDF+EPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 12. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 195.6 bits 766,  Expect = 4e-52
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G HLTSAAI+G+DGSVWA+S NFP++KPEE+AGIV DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGMAL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 13. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 195.6 bits 766,  Expect = 4e-52
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HL SAAILGHDG+VWA+S +FP+FKPEEI GI+KDF+EPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 14. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 195.4 bits 765,  Expect = 5e-52
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL CEI+G+HLTSAAI+GHDG+VWA+S  FP FKPEE+A I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG AL++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIDQG 130
            +LGDYLI+QG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 15. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 195.1 bits 764,  Expect = 6e-52
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HLTSAAI+GHDG+ WA+S  FP+FKPEE+A I+KDF+EPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 16. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 194.6 bits 762,  Expect = 8e-52
 Identities = 103/130 79%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL C+IDG+HLT+AAI+GHDGSVWA+S +FP+FKPEE+A I+KDF+EPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 17. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 194.4 bits 761,  Expect = 9e-52
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEIDGQHLT+AAI+GHDGSVWA+S +FP+FKPEEIA I+KDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GGIT+KKTG ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 18. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 194.4 bits 761,  Expect = 9e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+IDGQ LT+AAI+GHDGSVWA+S  FP+ KPEEIA I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT +ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYL DQG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 19. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 193.9 bits 759,  Expect = 1e-51
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL CEI+G HL++AAI+G+DGSVWA+S NFP+FK EEI GI+ DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 20. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 193.4 bits 757,  Expect = 2e-51
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+I+G HLT AAI+G+DGSVWA+S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 21. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 192.9 bits 755,  Expect = 3e-51
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HLTSAAI+GHDG+VWA+S  FP+FKPEE+  I+KDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 22. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 192.9 bits 755,  Expect = 3e-51
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+IDG+HLT+AAILGHDGSVWA+S  FPKFKPEEI  I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKT  AL++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 23. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 192.7 bits 754,  Expect = 3e-51
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL CEI+G HLTSAAI+G+DGSVWA+S NFP++KPEEI GI+ DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL++GG+KYMVIQGEPG VIRGKKG GG+T+KKT +AL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 24. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 192.7 bits 754,  Expect = 3e-51
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C I+G HLT AAI+G+DGSVW +S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 25. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 192.6 bits 754,  Expect = 3e-51
 Identities = 104/130 80%, Positives = 122/130 93%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLCCEIDG---QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
            MSWQ YVDDHL CE+DG   Q+L++AAI+GHDGSVWA+S  FPKFKPEEI GI+K+F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
            GHLAPTGL+LGGTKYMVIQGEP  VIRGKKG+GG+TIKKTG AL++G+YDEP+TPGQCNL
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIDQG 130
            +VERLGDYLI+QG
Sbjct  121  IVERLGDYLIEQG 133

Sequence Alignment: 26. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 192.4 bits 753,  Expect = 4e-51
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL CEI+G HL++AAI+GH+GSVWA+S  FP++KPEE+ GI+ DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ MAL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 27. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 192.4 bits 753,  Expect = 4e-51
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLCCEIDG---QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
            MSWQAYVDDHL CE++G   Q LT+AAI+GHDGSVWA+S  FP+ KPEEIAGI+KDF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG AL++G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIDQG 130
            +VERLGDYLIDQG
Sbjct  121  IVERLGDYLIDQG 133

Sequence Alignment: 28. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 191.9 bits 751,  Expect = 5e-51
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDD L C+IDG+HLT+AAILGHDGSVWA S  FPKFKPEEI  I+KDF+EPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG AL++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 29. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 191.7 bits 750,  Expect = 6e-51
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HL SAAI+GHDG+VWA+S +FP+FKPEEI GI+KD++EPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTG+F+   KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 30. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 191.4 bits 749,  Expect = 7e-51
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G+HL+SAAI+GHDG+VWA+S  FP+FKPEE+  I+KDF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 31. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 191.2 bits 748,  Expect = 8e-51
 Identities = 99/130 76%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL CEI+G HL++AAI+GHDGSVWA+S  FP++KPEE+ GI+ DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KK+ +AL++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 32. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 191.2 bits 748,  Expect = 8e-51
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+IDG+ LT+AAI+GHDGSVWA+S +FP+FK +E+A ++KDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLLDQG 130

Sequence Alignment: 33. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 190.5 bits 745,  Expect = 1e-50
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+IDG  LT+AAILG+DGSVW++S +FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT  AL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 34. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 190.0 bits 743,  Expect = 2e-50
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVD+HL CEI+G+HL +AAI+GHDG+ WA+S  FP+FK E++A I+KDF+EPGHL
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 35. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 189.7 bits 742,  Expect = 2e-50
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQAYVDDHL CEI+G   HLT AAILG DGSVWA+S +FP+FKP+EIA IV+DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG AL++GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGY 131
            VERLGDYLI+QGY
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 36. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 189.5 bits 741,  Expect = 3e-50
 Identities = 100/130 76%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+IDG+ LT+AAI+GHDGSVWA+S  FP+FK +E+A ++KDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 37. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 189.2 bits 740,  Expect = 3e-50
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVD+HL CEIDG+HLT+AAILGHDGSVWA+S +FP+FK EEI  I+ DF EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 38. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 189.2 bits 740,  Expect = 3e-50
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+I+G HL+SAAILGHDG+VWA+SP+FP++KPEE++ I+KDF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT  ALI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            R+GDYL++QG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 39. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 188.7 bits 738,  Expect = 5e-50
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+I+G  LTSAAI+GHDGSVWA S +FP+F  EE++ I+KDFEEPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GG+T+KKT  ALI+G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 188.5 bits 737,  Expect = 5e-50
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+IDG  LT+AAILG+DGSVW++S  FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 41. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 188.0 bits 735,  Expect = 8e-50
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVD+HL C+IDGQ  HL +AAI+GHDGSVWA+S NFP+FK EEI+ I+KDFEEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
            HLAPTGL LGGTKYMVIQGE G VIRGKKG+GG+TIKKT  AL++GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 42. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 188.0 bits 735,  Expect = 8e-50
 Identities = 101/130 77%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVDDHL C+IDGQ  HL +A+I+GHDGS+WA+S +FP++KPEEI GI+KDF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 43. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 187.5 bits 733,  Expect = 1e-49
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAY D+HL CEI+G  L +AAI+GHDGSVWA+S  FP++KPEEI G++ DF EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 187.2 bits 732,  Expect = 1e-49
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDGQ--HLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVD+HL C+IDGQ  HLT+AAI+GHDGS+WA+S +FP++K +EI  I KDFEEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG ALI+GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 45. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 187.0 bits 731,  Expect = 2e-49
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+I+G HLTSAAI+G+DGSVWA+S NFP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDY+I+QG
Sbjct  121  RLGDYIIEQG 130

Sequence Alignment: 46. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 187.0 bits 731,  Expect = 2e-49
 Identities = 102/130 78%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DGSVW++S  FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 47. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 187.0 bits 731,  Expect = 2e-49
 Identities = 102/130 78%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DGSVW++S  FP FKPEEIA I+KDF++PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 48. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 186.8 bits 730,  Expect = 2e-49
 Identities = 102/130 78%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+IDG  LT+AAILG+DGSVW++S  FP FKPEEIA I+KD+++PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 49. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 186.0 bits 727,  Expect = 3e-49
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+IDG+ LT+AAI+GHDGSVWA+S +FP+FK +E+A I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 50. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 186.0 bits 727,  Expect = 3e-49
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDGQHLTS--AAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVD+HL C+IDGQ   S  +AI+GHDGSVWA+S +FP+FKP+EI GI+KDFEEPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
            HLAPTGL LGG KYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLIDQG
Sbjct  121  VERLGDYLIDQG 132

Sequence Alignment: 51. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 185.8 bits 726,  Expect = 4e-49
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL C++DG+ LTSAAILGHDGSVWA+S  FP++KP EI  I+ DF EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ MALI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 52. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 185.3 bits 724,  Expect = 5e-49
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLCCEIDGQH---LTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
            MSWQAYVDDHL C+I+G+    LT+AAI+GHDGSVWA+S  FP+FKPEE+ GI+ DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            VVERLGDYL++QG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 53. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 184.8 bits 722,  Expect = 7e-49
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLCCEIDGQH---LTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
            MSWQAYVDDHL C+I+G+    LT+AAI+GHDGSVWA+S  FP+FKPEE+ GI+ DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            VVERLGDYL++QG
Sbjct  121  VVERLGDYLLEQG 133

Sequence Alignment: 54. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 183.6 bits 717,  Expect = 2e-48
 Identities = 98/130 75%, Positives = 113/130 86%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ Y D+HL CEI+G  L +AAI+GHDGSVWA+S  FP++KPEEI G++ DF EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIR KKG GG+T+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 55. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 183.6 bits 717,  Expect = 2e-48
 Identities = 101/129 78%, Positives = 113/129 87%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL CEI+G  LTSAAI+G+DGSVWA+S  FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 56. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 183.6 bits 717,  Expect = 2e-48
 Identities = 101/129 78%, Positives = 114/129 88%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CE +G HLTSAAI+G+DG+VWA+S NFP+FKPEEI GI+ DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 57. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 183.6 bits 717,  Expect = 2e-48
 Identities = 101/129 78%, Positives = 114/129 88%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CE +G HLTSAAI+G+DG+VWA+S NFP+FKPEEI GI+ DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 58. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 183.6 bits 717,  Expect = 2e-48
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLCCEIDGQH---LTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
            MSWQAYVDDHL C+I+G+    LT+AAI+GHDGSVWA+S  FP+FKPEE+ GI+ DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG AL++GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            V ERLGDYL++QG
Sbjct  121  VAERLGDYLLEQG 133

Sequence Alignment: 59. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 182.8 bits 714,  Expect = 3e-48
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL C+++G  LT+AAILG+DGSVWA+S NFP++KPEEI GI  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLF+GGTKYMVIQGEP  VIRGKKG GG+TIKKT  A+++GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 60. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 182.8 bits 714,  Expect = 3e-48
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQAYVDDHL C+IDG  LT+AAILG+DGSVW++S  FP F+ EEIA I+KDF++PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 61. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 182.8 bits 714,  Expect = 3e-48
 Identities = 98/130 75%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+HL CEI+G HL+SAAILG+DG VWA+S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT  ALI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDTG 130

Sequence Alignment: 62. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 182.6 bits 713,  Expect = 3e-48
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLCCEI-DGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGH 59
            MSWQAYVDDHL C++ DG    SAAI+GHDGSVWA+S NFP++KPEE+ GI+ DF E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIDQG 130
            ERLGDYL++QG
Sbjct  121  ERLGDYLLEQG 131

Sequence Alignment: 63. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 182.1 bits 711,  Expect = 5e-48
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVDDHL C+I+G   HLT AAILG DGSVWA+S NFP+FKP+EIA IVK+F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 64. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 182.1 bits 711,  Expect = 5e-48
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVDDHL CEI+G   HL++AAILG DGSVWA+S +FP+FKP+EI+ +VKDF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 65. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 179.9 bits 702,  Expect = 2e-47
 Identities = 100/129 77%, Positives = 115/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLCCEI-DGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGH 59
            MSWQAYVDDHL C++ DG  L SAAI+GHDGSVWA+S NFP++KPEE+ GI+ DF E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIDQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 66. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 179.9 bits 702,  Expect = 2e-47
 Identities = 97/130 74%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVD+ L CEI+G HLT+AAI+G+DGSVWA+S NFP+FK EEI  I+ DF+EPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+T++KT  ALI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 67. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 179.9 bits 702,  Expect = 2e-47
 Identities = 99/128 77%, Positives = 113/128 88%, Gaps = 0/128 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ+YVDDHL C+++G HLT+AAILG+DGSVWA+S  FP++KP+EI GI KDFEEPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
            APTGLFLGG KYMVIQGE G VIRGKKG GG+TIKKT  AL++G YDEPMT GQCNLVVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLID 128
            RLGDYLI+
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 68. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 179.9 bits 702,  Expect = 2e-47
 Identities = 97/130 74%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQAYVD+HL C+I+G  QHLTSAAILG DG+VWA+S  FP+FKPEE+ GI+K+F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG A+I+GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 69. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 179.4 bits 700,  Expect = 3e-47
 Identities = 98/130 75%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            M WQ YVDDHL CEI+G   HL+ AAILG DGSVWA+S +FP+FKP+EIA +VKDF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG  IRGKKG GGI +KKTG AL++GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 70. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 179.4 bits 700,  Expect = 3e-47
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVDDHL CEI+G   HLT+AAILG DGSVWA+S NFP+FKP+EI+ +VK+F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 71. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 178.4 bits 696,  Expect = 6e-47
 Identities = 98/130 75%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVDDHL C+I+G  QHLTSAAI+G DG+VWA+S +FP+FKP EI  I+K+F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
            +LAPTGLFLGG KYMVIQGE G VIRGKKG GGI IKKTG A+++GIYDEP+ PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 72. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 176.2 bits 687,  Expect = 3e-46
 Identities = 95/129 73%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQ YVDDHL C+I+G  QHLT+AAILG DG+VWA+S  FP+FKPEE+ GI+ +F E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG A+++GIYDEP+ PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIDQ 129
            VERLGDYL+DQ
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 73. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 176.2 bits 687,  Expect = 3e-46
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLCCEIDGQH---LTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
            MSWQAYVDDHL C+I+G+    LT+AAI+GHDGSVWA+S  FP+FKPEEI GI+ DF EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKT  AL++GIY+EP+TPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            VV RLGD L+ QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 171.5 bits 668,  Expect = 7e-45
 Identities = 96/130 73%, Positives = 111/130 85%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLCCEID--GQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
            MSWQAYVD+HL C I+  G HLTS+AI+G DGS+WA+S NFP+ KP+EI  I K+F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT  ALI+GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 152.1 bits 588,  Expect = 4e-39
 Identities = 82/109 75%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
            MSWQ YVDDHL CEI+G +LTSAAI+G+DGS+WA+S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEP 109
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KKT  ALI+GIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 137.7 bits 531,  Expect = 1e-34
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 28/131 21%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPK------------------- 41
            MSWQ YVDDHL C+++G+HL SAAILG DGSVWA+SP FPK                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGI 92
                     FKPEEI  I+KDF+EPG LAPTGLFLGGTKYMVIQGEPG VIRGKKG+ GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY 131
            TIKKTG ALI+GIY+EP+TPGQCN+VVE++GDYL+DQGY
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.0 bits 271,  Expect = 2e-15
 Identities = 51/127 40%, Positives = 75/127 59%, Gaps = 8/127 6%
Query  1    MSWQAYVDDHLCCEIDGQHLTSAAILG-HDGSVWAE-SPNFPK-FKPEEIAGIVKDFE-E 56
            MSWQ+YVD+++C  +D +    A I G +DG+VWA+   ++PK    +E+  I       
Sbjct  1    MSWQSYVDNQICQHVDCRL---AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCN 116
            P  +   G+ LGG KY+ IQ +  +V RG+KG+  + I  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQADNSLV-RGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  LVVERLGDYLIDQGY 131
             VVE+LGDYL    Y
Sbjct  117  NVVEKLGDYLKANNY 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.