The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL
APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
RLGDYLIDQGY
Sequence Info Allergen Name Length Opt Bits Score E Value
O65810 Gly m 3 131 903 247.7 7.6e-68
O65809 Gly m 3 131 878 241.0 7.8e-66
Q9STB6 Hev b 8.0102 131 808 222.3 3.3e-60
Q5XWE1 Citr l 2.0101 131 799 219.9 1.8e-59
CAD37202 Pru p 4.0201 131 792 218.1 6.4e-59
Q9XF41 Mal d 4 131 788 217.0 1.3e-58
Q9AXH4 Cor a 2 131 787 216.7 1.6e-58
AAL29690 Lyc e 1 131 786 216.4 1.9e-58
AAP13533 Cuc m 2 131 784 215.9 2.8e-58
CAD10376 Cap a 2 131 783 215.6 3.4e-58
AAL07320 Lit c 1 131 776 213.8 1.2e-57
Q9SQI9 Ara h 5 131 774 213.2 1.8e-57
Q9M7N0 Hev b 8.0201 131 771 212.4 3.1e-57
AAK01235 Cor a 2 131 771 212.4 3.1e-57
AAL92870 Che a 2 131 767 211.4 6.5e-57
Q93YG7 Sola l 1.0101 131 766 211.1 7.9e-57
CAD10377 Lyc e 1 131 766 211.1 7.9e-57
O65812 Hev b 8.0101 131 764 210.6 1.1e-56
ACP43298 Ama r 2.0101 133 763 210.3 1.4e-56
Q8L5D8 Pho d 2.0101 131 760 209.5 2.4e-56
AAK54835 Ana c 1 131 760 209.5 2.4e-56
FM164277 Tri a 12.0104 131 759 209.2 2.9e-56
AF377948 Mus a 1.0101 131 759 209.2 2.9e-56
Q9LEI8 Hev b 8.0204 131 757 208.7 4.2e-56
Q9XF38 Pyr c 4 131 757 208.7 4.2e-56
A0A2I4DNN6 Jug r 7.0101 131 755 208.2 6e-56
Q9FR39 Zea m 12.0105 131 754 207.9 7.3e-56
P49233 Tri a 12.0102 141 754 207.9 7.9e-56
Q9FUD1 Ory s 12.0101 131 752 207.4 1.1e-55
O24650 Phl p 12.0102 131 751 207.1 1.3e-55
Q9M7M8 Hev b 8.0203 131 750 206.8 1.5e-55
QID21357 Pop n 2.0101 131 750 206.8 1.5e-55
P49232 Tri a 12.0101 138 750 206.8 1.6e-55
Q9XF40 Mal d 4 131 749 206.6 1.8e-55
O04725 Cyn d 12 131 749 206.6 1.8e-55
Q9XF42 Mal d 4 131 747 206.0 2.7e-55
P35081 Zea m 12.0101 131 746 205.8 3.2e-55
CAD37201 Pru p 4.0101 131 745 205.5 3.8e-55
CAA54686 Phl p 12.0101 131 744 205.2 4.6e-55
P35079 Phl p 12.0101 131 744 205.2 4.6e-55
O22655 Zea m 12.0104 131 744 205.2 4.6e-55
P35083 Zea m 12.0103 131 743 205.0 5.6e-55
P52184 Hor v 12.0101 131 742 204.7 6.7e-55
P49234 Tri a 12.0103 140 742 204.7 7.2e-55
AY081852 Pru du 4.0102 131 739 203.9 1.2e-54
AY081850 Pru du 4.0101 131 739 203.9 1.2e-54
Q9XF39 Pru av 4 131 738 203.6 1.4e-54
A0A023W2L7 Pro j 2.0101 133 738 203.6 1.4e-54
Q9M7M9 Hev b 8.0202 131 736 203.1 2e-54
O24282 Phl p 12.0103 131 734 202.6 2.9e-54
ABU95412 Sin a 4.0101 131 732 202.0 4.3e-54
A0A0A0REA1 Koc s 2.0101 133 731 201.8 5.2e-54
Q9XF37 Api g 4 134 729 201.2 7.6e-54
O24169 Ole e 2 134 726 200.4 1.3e-53
P35082 Zea m 12.0102 131 725 200.2 1.6e-53
O24170 Ole e 2 134 723 199.6 2.3e-53
P84177 Cit s 2.0101 131 722 199.4 2.7e-53
Q5EF31 Cro s 1.0101 131 720 198.8 3.9e-53
ACS34771 Sal k 4.0101 133 719 198.6 4.8e-53
AAL76933 Dau c 4 134 719 198.6 4.9e-53
O24171 Ole e 2 134 718 198.3 5.8e-53
A0A0A0RCW1 Aca f 2 133 717 198.0 7e-53
Q9XG85 Par j 3 132 716 197.8 8.3e-53
O49894 Mer a 1 133 710 196.1 2.5e-52
Q42449 Ara t 8 131 706 195.1 5.3e-52
QVU02258 Que ac 2.0101 133 706 195.1 5.3e-52
Q9T0M8 Par j 3 131 705 194.8 6.3e-52
XP030492464 Can s 2.0101 133 704 194.5 7.7e-52
QRN65366 Lig v 2.0101 134 704 194.5 7.8e-52
ADK22841 Sal k 4.0201 133 701 193.7 1.3e-51
P25816 Bet v 2 133 697 192.7 2.8e-51
AJ421030 Art v 4.0101 133 688 190.3 1.5e-50
O81982 Hel a 2 133 684 189.2 3.1e-50
AJ421031 Art v 4.0201 133 683 188.9 3.8e-50
FG438715 Act d 9.0101 109 654 181.2 6.4e-48
QEQ43417 Sola m 1.0101 159 527 147.2 1.6e-37
A0A1B2YLJ4 Tyr p 36.0101 131 273 79.4 3.4e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 247.7 bits 903,  Expect = 8e-68
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 2. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 241.0 bits 878,  Expect = 8e-66
 Identities = 128/131 97%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLC IEGNHLTHAAIIGQDGSVW QSTDFPQFKPEEITAIMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            R GDYLIDQGY
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 222.3 bits 808,  Expect = 3e-60
 Identities = 115/131 87%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C IEGNHL+ AAIIGQDGSVW QS +FPQFK EEIT IM+DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 4. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 219.9 bits 799,  Expect = 2e-59
 Identities = 112/130 86%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C IEGNHLT AAIIGQDGSVW +S +FPQ+KPEEIT I+NDFNEPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLY+GG+KYMVIQGEPGAVIRGKKGPGGVTVKKT  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 5. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 218.1 bits 792,  Expect = 6e-59
 Identities = 111/130 85%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C IEGNHL+ AAIIG+DGSVW QS  FPQ+KPEE+T I+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 6. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 217.0 bits 788,  Expect = 1e-58
 Identities = 112/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C IEGNHL+ AAIIG++GSVW QS  FPQ+KPEE+T IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 7. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 216.7 bits 787,  Expect = 2e-58
 Identities = 113/130 86%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAY D+HL+C IEGN L  AAIIG+DGSVW QS+ FPQ+KPEEIT +MNDFNEPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 8. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 216.4 bits 786,  Expect = 2e-58
 Identities = 112/130 86%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C IEGNHLT AAIIGQDGSVW QS +FPQFKPEEITAIMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDY+I+QG
Sbjct  121  RLGDYIIEQG 130

Sequence Alignment: 9. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 215.9 bits 784,  Expect = 3e-58
 Identities = 109/130 83%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEGNHLT AAIIGQDGSVW QS +FPQ+KPEE+  I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTG AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 10. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 215.6 bits 783,  Expect = 3e-58
 Identities = 113/129 87%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C IEGN LT AAIIGQDGSVW QS  FPQFKPEEITAIMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 11. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 213.8 bits 776,  Expect = 1e-57
 Identities = 110/130 84%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C  +G HLT AAIIG+DGSVW QS +FPQFKP EI AIM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKGPGG+TVKKT  ALIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLVDQG 130

Sequence Alignment: 12. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 213.2 bits 774,  Expect = 2e-57
 Identities = 109/130 83%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HLLC IEG+HL+ AAI+GQDG VW QS+ FPQFKPEEITAIMNDF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGA+I GKKGPGGVT++KT  ALIIGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLID G
Sbjct  121  RLGDYLIDTG 130

Sequence Alignment: 13. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 212.4 bits 771,  Expect = 3e-57
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C I+G+HLT AAIIG+DGSVW QS+ FPQFKPEE+ AIM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 14. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 212.4 bits 771,  Expect = 3e-57
 Identities = 111/130 85%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ Y D+HL+C IEGN L  AAIIG+DGSVW QS+ FPQ+KPEEIT +MNDFNEPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIR KKGPGGVTVKKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 15. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 211.4 bits 767,  Expect = 7e-57
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C IEGNHL+ AAI+G+DG+VW QS  FPQ+KPEE++AIM DFNEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KKT  ALIIGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            R+GDYL++QG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 16. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 211.1 bits 766,  Expect = 8e-57
 Identities = 109/129 84%, Positives = 117/129 90%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HLLC  EGNHLT AAIIGQDG+VW QS +FPQFKPEEIT IMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 17. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 211.1 bits 766,  Expect = 8e-57
 Identities = 109/129 84%, Positives = 117/129 90%, Gaps = 0/129 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HLLC  EGNHLT AAIIGQDG+VW QS +FPQFKPEEIT IMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP AVIRGKKGPGG+T+KKT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQ 129
            RLGDYLI+Q
Sbjct  121  RLGDYLIEQ 129

Sequence Alignment: 18. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 210.6 bits 764,  Expect = 1e-56
 Identities = 109/130 83%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+ L+C IEGNHLT AAIIGQDGSVW QS++FPQFK EEITAIM+DF+EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKGPGGVTV+KT  ALIIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 19. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 210.3 bits 763,  Expect = 1e-56
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQAYVDDHL+C IEG  NHLT AAI+G DGSVW QS DFPQFKP+EI AI+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG GG+ VKKTG AL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQGY 131
            VERLGDYLI+QGY
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 20. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 209.5 bits 760,  Expect = 2e-56
 Identities = 110/130 84%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVD+HL+C I+G+HLT AAI+G+DGSVW QS+ FPQFK EEIT IMNDFNEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPGAVIRGKKG GGVTVKKT  ALI GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 21. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 209.5 bits 760,  Expect = 2e-56
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C I+G HL+ AAI+G+D +VW QS +FPQFKPEEI+AI+NDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GG+TVKKT  ALIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 22. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 209.2 bits 759,  Expect = 3e-56
 Identities = 106/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSW+AYVDDHL C I+G HLT AAI+G+DGSVW QS +FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 23. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 209.2 bits 759,  Expect = 3e-56
 Identities = 110/131 83%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLC I+G  LT AAI+G+DGSVW QS  FPQ KPEEI AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGAVIRGKKG GGVT+KKT  ALIIGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYL DQG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 24. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 208.7 bits 757,  Expect = 4e-56
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C I+G+ LT AAIIG+DGSVW QS+ FPQFK +E+ A+M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL+DQG
Sbjct  121  RLGDYLLDQG 130

Sequence Alignment: 25. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 208.7 bits 757,  Expect = 4e-56
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C I+G+HLT AAI+G+DGSVW QS+ FP+FKPEEITAIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKT  AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 26. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 208.2 bits 755,  Expect = 6e-56
 Identities = 106/130 81%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C I+G HLT AAIIG+DGSVW QS+ FPQFKPEEI AIM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKTG ALI GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 27. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 207.9 bits 754,  Expect = 7e-56
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHLLC IEG HL+ AAI+G+DGSVW QS +FP++KPEE+  ++ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTG +LIIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 28. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 207.9 bits 754,  Expect = 8e-56
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL C I+G HLT AAI+G+DGSVW +S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 29. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 207.4 bits 752,  Expect = 1e-55
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HLT AAI+G+DG+VW QS  FPQFKPEE+T IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 30. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 207.1 bits 751,  Expect = 1e-55
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HL  AAI+G+DG+VW QS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 31. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 206.8 bits 750,  Expect = 2e-55
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C I+G+ LT AAIIG+DGSVW QS+ FPQFK +E+ A+M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 32. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 206.8 bits 750,  Expect = 2e-55
 Identities = 107/130 82%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C IEGN LT AAIIG+DGSVW  S  FPQF  EE++AIM DF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GGVTVKKT  ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 206.8 bits 750,  Expect = 2e-55
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL C I+G HLT AAI+G+DGSVW +S +FP+FKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 34. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 206.6 bits 749,  Expect = 2e-55
 Identities = 106/130 81%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDD L+C I+G+HLT AAI+G+DGSVW +S+ FP+FKPEEITAIM DF+EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GGVTVKKTG AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLIDQG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 35. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 206.6 bits 749,  Expect = 2e-55
 Identities = 106/130 81%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C IEG+HLT AAIIG+DG+VW QS  FP FKPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GGVTVKKTG AL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIDQG 130
            +LGDYLI+QG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 36. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 206.0 bits 747,  Expect = 3e-55
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C I+GN LT AAI+GQDGSVW QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGAVIRGKKG GG+T+KKT  AL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 37. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 205.8 bits 746,  Expect = 3e-55
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HLT AAI+G+DG+ W QST FP+FKPEE+ AIM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPGAVIRGKKG GG+TVKKTG +LIIGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 38. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 205.5 bits 745,  Expect = 4e-55
 Identities = 105/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C I+GN LT AAI+GQDGSVW QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 39. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 205.2 bits 744,  Expect = 5e-55
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HL  AAI+G+DG+VW QS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 40. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 205.2 bits 744,  Expect = 5e-55
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HL  AAI+G+DG+VW QS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 41. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 205.2 bits 744,  Expect = 5e-55
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVD+HL+C IEG HL+ AAI+G+DGSVW QS  FP++KPEE+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTG +LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 42. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 205.0 bits 743,  Expect = 6e-55
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HL+ AAI+G+DG+VW QST FPQFKPEE+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 43. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 204.7 bits 742,  Expect = 7e-55
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL C I+G HLT AAI+G+DG VW+QS +FPQFKPEEI  I+ DF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG  LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 44. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 204.7 bits 742,  Expect = 7e-55
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSW+AYVDDHL C I+G +LT AAI+G+DGSVW QS +FPQFKPEE   I+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG ALI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLIDQGY
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 45. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 203.9 bits 739,  Expect = 1e-54
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C I+GN LT AAI+GQDGSVW QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 46. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 203.9 bits 739,  Expect = 1e-54
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C I+GN LT AAI+GQDGSVW QS  FP FKPEEI AI+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 47. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 203.6 bits 738,  Expect = 1e-54
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C I+GN LT AAI+GQDGSVW QS  FP FKPEEI AI+ D+++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 48. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 203.6 bits 738,  Expect = 1e-54
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C IEG  NHL+ AAI+G DGSVW QS  FPQFKP+EI+A++ DF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKGPGG+ VKKTG ALIIGIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 49. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 203.1 bits 736,  Expect = 2e-54
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C I+G+ LT AAIIG+DGSVW QS+ FPQFK +E+ AIM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 50. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 202.6 bits 734,  Expect = 3e-54
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C IEG+HL  AAI G+DG+VW QS DFPQFKPEEIT IM D++EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPGAVIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 51. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 202.0 bits 732,  Expect = 4e-54
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C +EGN LT AAI+GQDGSVW QS +FPQ+KPEEI  I NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP AVIRGKKG GGVT+KKT  A++ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 52. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 201.8 bits 731,  Expect = 5e-54
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C IEG  NHLT AAI+G DGSVW QS +FPQFKP+EI AI+ +F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKTG ALI GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 53. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 201.2 bits 729,  Expect = 8e-54
 Identities = 104/130 80%, Positives = 115/130 88%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCGIEGNH---LTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+C +EGN    LT AAIIG+DGSVW QS+ FPQ KPEEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GGVT+KKTG AL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIDQG 130
            +VERLGDYLIDQG
Sbjct  121  IVERLGDYLIDQG 133

Sequence Alignment: 54. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 200.4 bits 726,  Expect = 1e-53
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCGIEG--NH-LTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+C IEG  +H LT AAI+G+DGSVW QS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            VVERLGDYL++QG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 55. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 200.2 bits 725,  Expect = 2e-53
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVD+HL+C IEG+HL  AAI+G+DG+ W QST FP+FK E++  IM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIDQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 56. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 199.6 bits 723,  Expect = 2e-53
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCGIEGNH---LTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+C IEG+    LT AAI+G+DGSVW QS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            VVERLGDYL++QG
Sbjct  121  VVERLGDYLLEQG 133

Sequence Alignment: 57. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 199.4 bits 722,  Expect = 3e-53
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQAYVDDHL+C I+GN LT AAI+GQDGSVW QS  FP F+ EEI AI+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIDQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 58. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 198.8 bits 720,  Expect = 4e-53
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVD+HL+C ++G+ LT AAI+G+DGSVW QS  FP++KP EITAI+NDFNEPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTG+Y+ G KYMVIQGEPG VIRGKKG GGVT+KK+  ALI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIDQGY 131
            RLGDYLI+QGY
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 59. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 198.6 bits 719,  Expect = 5e-53
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C IEG  NHLT AAI+G DGSVW QS +FPQFKP+EI+A++ +F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKTG ALI GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 60. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 198.6 bits 719,  Expect = 5e-53
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCGIEGN---HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQ YVDDHL+C ++GN   +L+ AAIIG+DGSVW QS+ FP+FKPEEIT IM +F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP AVIRGKKG GGVT+KKTG AL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIDQG 130
            +VERLGDYLI+QG
Sbjct  121  IVERLGDYLIEQG 133

Sequence Alignment: 61. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 198.3 bits 718,  Expect = 6e-53
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCGIEGNH---LTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+C IEG+    LT AAI+G+DGSVW QS  FPQFKPEE+  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            V ERLGDYL++QG
Sbjct  121  VAERLGDYLLEQG 133

Sequence Alignment: 62. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 198.0 bits 717,  Expect = 7e-53
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            M WQ YVDDHL+C IEG  NHL+ AAI+G DGSVW QS  FPQFKP+EI A++ DF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG  IRGKKGPGG+ VKKTG AL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 63. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 197.8 bits 716,  Expect = 8e-53
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLLCGI-EGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGS 59
            MSWQAYVDDHL+C + +GN    AAIIG+DGSVW QS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIDQG 130
            ERLGDYL++QG
Sbjct  121  ERLGDYLLEQG 131

Sequence Alignment: 64. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 196.1 bits 710,  Expect = 3e-52
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C I+G   HL  A+I+G+DGS+W QS  FPQ+KPEEIT IM DF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGLY+ GTKYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 65. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 195.1 bits 706,  Expect = 5e-52
 Identities = 99/128 77%, Positives = 110/128 85%, Gaps = 0/128 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ+YVDDHL+C +EGNHLT AAI+GQDGSVW QS  FPQ+KP+EI  I  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
            APTGL+LGG KYMVIQGE GAVIRGKKGPGGVT+KKT  AL+ G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLID 128
            RLGDYLI+
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 66. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 195.1 bits 706,  Expect = 5e-52
 Identities = 101/130 77%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVD+HL+C I+G   HL  AAIIG+DGSVW QS++FPQFK EEI+ IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGL+LGGTKYMVIQGE GAVIRGKKG GGVT+KKT  AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 67. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 194.8 bits 705,  Expect = 6e-52
 Identities = 102/129 79%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLLCGI-EGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGS 59
            MSWQAYVDDHL+C + +GN L  AAIIG+DGSVW QS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE GAVI GKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIDQG 130
            ERLGDYL++QG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 68. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 194.5 bits 704,  Expect = 8e-52
 Identities = 101/130 77%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVD+HL+C I+G   HLT AAIIG+DGS+W QS+ FPQ+K +EIT I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGL+L GTKYMVIQGEPGAVIRGKKG GGVT+KKTG ALI GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 69. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 194.5 bits 704,  Expect = 8e-52
 Identities = 102/130 78%, Positives = 114/130 87%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLLCGIEG--NH-LTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQAYVDDHL+C IEG  +H LT AAI+G+DGSVW QS  FPQFKPEEI  IM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G+LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+T+KKT  AL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIDQG 130
            VV RLGD L+ QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 70. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 193.7 bits 701,  Expect = 1e-51
 Identities = 99/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIE--GNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQAYVD+HL+C IE  GNHLT +AI+G DGS+W QS++FPQ KP+EI AI  +F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMVIQGEPGAVIRGKKGPGGV +KKT  ALI GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 71. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 192.7 bits 697,  Expect = 3e-51
 Identities = 100/129 77%, Positives = 114/129 88%, Gaps = 4/129 3%
Query  1    MSWQAYVDDHLLCGIEG---NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
            MSWQ YVD+HL+C I+G   N L  +AI+G+DGSVW QS+ FPQFKP+EIT IM DF EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLA-SAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGE GAVIRGKKG GG+T+KKTG AL+ GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  VVERLGDYLIDQG 130
            VVERLGDYLIDQG
Sbjct  120  VVERLGDYLIDQG 132

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 190.3 bits 688,  Expect = 1e-50
 Identities = 96/130 73%, Positives = 109/130 83%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C IEG   HLT AAI G DG+VW +S  FP+FKP EI AI+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE GAVIRGKKG GG+ +KKTG A++ GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL+DQG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 73. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 189.2 bits 684,  Expect = 3e-50
 Identities = 93/130 71%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQAYVD+HL+C IEG   HLT AAI+G DG+VW QS  FPQFKPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG GG+ +KKTG A+I+GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIDQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 188.9 bits 683,  Expect = 4e-50
 Identities = 93/129 72%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
            MSWQ YVDDHL+C IEG   HLT AAI+G DG+VW +S  FP+FKPEE+  I+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMV+QGE GAVIRGKKG GG+ +KKTG A+++GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIDQ 129
            VERLGDYL+DQ
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 181.2 bits 654,  Expect = 6e-48
 Identities = 95/109 87%, Positives = 100/109 91%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
            MSWQ YVDDHL+C IEGN+LT AAIIGQDGS+W QS  FPQFKPEEITAIMNDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEP 109
            APTGLYLGGTKYMVIQGE GAVIRGKKGPGGVTVKKT  ALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 147.2 bits 527,  Expect = 2e-37
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 28/131 21%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQ------------------- 41
            MSWQ YVDDHL+C +EG+HL  AAI+G DGSVW QS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITAIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGV 92
                     FKPEEIT IM DF+EPG LAPTGL+LGGTKYMVIQGEPGAVIRGKKG  G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLIDQGY 131
            T+KKTG ALI GIY+EP+TPGQCNMVVE++GDYL+DQGY
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 79.4 bits 273,  Expect = 3e-17
 Identities = 51/127 40%, Positives = 76/127 59%, Gaps = 8/127 6%
Query  1    MSWQAYVDDHLLCGIEGNHLTHAAIIG-QDGSVWLQ-STDFP-QFKPEEITAIMNDF-NE 56
            MSWQ+YVD+++ C      L  A I G QDG+VW +   D+P Q   +E+  I +   + 
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCN 116
            P S+   G++LGG KY+ IQ +  +++RG+KG   + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERLGDYLIDQGY 131
             VVE+LGDYL    Y
Sbjct  117  NVVEKLGDYLKANNY 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.