The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF
LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV
ERLGDYLLEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9XG85 Par j 3 132 895 242.5 2.8e-66
Q9T0M8 Par j 3 131 855 232.0 4.2e-63
Q9AXH4 Cor a 2 131 746 203.2 1.9e-54
O49894 Mer a 1 133 746 203.2 1.9e-54
CAD37202 Pru p 4.0201 131 744 202.7 2.7e-54
AAL29690 Lyc e 1 131 743 202.4 3.2e-54
O24170 Ole e 2 134 742 202.2 4e-54
Q9XF41 Mal d 4 131 741 201.9 4.6e-54
Q5XWE1 Citr l 2.0101 131 738 201.1 8e-54
Q9FUD1 Ory s 12.0101 131 737 200.9 9.6e-54
O24171 Ole e 2 134 737 200.8 1e-53
Q9M7N0 Hev b 8.0201 131 733 199.8 2e-53
O04725 Cyn d 12 131 732 199.5 2.4e-53
O24650 Phl p 12.0102 131 731 199.3 2.9e-53
AAK01235 Cor a 2 131 730 199.0 3.5e-53
CAD10376 Cap a 2 131 729 198.8 4.2e-53
O24169 Ole e 2 134 727 198.2 6.2e-53
Q9STB6 Hev b 8.0102 131 725 197.7 8.6e-53
Q9FR39 Zea m 12.0105 131 724 197.4 1e-52
CAA54686 Phl p 12.0101 131 724 197.4 1e-52
P35079 Phl p 12.0101 131 724 197.4 1e-52
CAD37201 Pru p 4.0101 131 724 197.4 1e-52
Q9XF37 Api g 4 134 724 197.4 1.1e-52
O65809 Gly m 3 131 723 197.2 1.2e-52
ABU95412 Sin a 4.0101 131 723 197.2 1.2e-52
Q9M7M8 Hev b 8.0203 131 723 197.2 1.2e-52
QID21357 Pop n 2.0101 131 723 197.2 1.2e-52
P35083 Zea m 12.0103 131 722 196.9 1.5e-52
Q9LEI8 Hev b 8.0204 131 722 196.9 1.5e-52
Q9XF42 Mal d 4 131 719 196.1 2.6e-52
AAL76933 Dau c 4 134 719 196.1 2.7e-52
AY081852 Pru du 4.0102 131 718 195.9 3.1e-52
AY081850 Pru du 4.0101 131 718 195.9 3.1e-52
Q9XF38 Pyr c 4 131 718 195.9 3.1e-52
FM164277 Tri a 12.0104 131 718 195.9 3.1e-52
Q9XF39 Pru av 4 131 717 195.6 3.7e-52
AAL92870 Che a 2 131 717 195.6 3.7e-52
A0A2I4DNN6 Jug r 7.0101 131 716 195.3 4.5e-52
O65810 Gly m 3 131 716 195.3 4.5e-52
AAP13533 Cuc m 2 131 716 195.3 4.5e-52
Q8L5D8 Pho d 2.0101 131 715 195.1 5.4e-52
O24282 Phl p 12.0103 131 714 194.8 6.4e-52
AAL07320 Lit c 1 131 713 194.5 7.7e-52
P49234 Tri a 12.0103 140 713 194.5 8.5e-52
P49233 Tri a 12.0102 141 713 194.5 8.6e-52
O22655 Zea m 12.0104 131 712 194.3 9.3e-52
P25816 Bet v 2 133 712 194.3 9.5e-52
QVU02258 Que ac 2.0101 133 711 194.0 1.1e-51
Q9XF40 Mal d 4 131 710 193.7 1.3e-51
AAK54835 Ana c 1 131 710 193.7 1.3e-51
P35081 Zea m 12.0101 131 709 193.5 1.6e-51
Q9M7M9 Hev b 8.0202 131 709 193.5 1.6e-51
AF377948 Mus a 1.0101 131 709 193.5 1.6e-51
P52184 Hor v 12.0101 131 708 193.2 1.9e-51
CAD10377 Lyc e 1 131 705 192.4 3.3e-51
Q93YG7 Sola l 1.0101 131 705 192.4 3.3e-51
P49232 Tri a 12.0101 138 703 191.9 5.2e-51
P84177 Cit s 2.0101 131 701 191.4 6.9e-51
P35082 Zea m 12.0102 131 700 191.1 8.3e-51
O65812 Hev b 8.0101 131 699 190.8 1e-50
Q5EF31 Cro s 1.0101 131 699 190.8 1e-50
QRN65366 Lig v 2.0101 134 699 190.8 1e-50
Q42449 Ara t 8 131 697 190.3 1.4e-50
O81982 Hel a 2 133 693 189.3 3.1e-50
XP030492464 Can s 2.0101 133 691 188.7 4.4e-50
ACP43298 Ama r 2.0101 133 691 188.7 4.4e-50
AJ421030 Art v 4.0101 133 689 188.2 6.4e-50
ACS34771 Sal k 4.0101 133 687 187.7 9.2e-50
A0A0A0REA1 Koc s 2.0101 133 683 186.6 1.9e-49
AJ421031 Art v 4.0201 133 679 185.6 3.9e-49
Q9SQI9 Ara h 5 131 677 185.0 5.6e-49
A0A023W2L7 Pro j 2.0101 133 676 184.8 6.8e-49
ADK22841 Sal k 4.0201 133 659 180.3 1.5e-47
A0A0A0RCW1 Aca f 2 133 656 179.5 2.6e-47
FG438715 Act d 9.0101 109 595 163.6 1.4e-42
QEQ43417 Sola m 1.0101 159 495 136.9 2.1e-34
A0A1B2YLJ4 Tyr p 36.0101 131 245 71.2 1.1e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 242.5 bits 895,  Expect = 3e-66
 Identities = 132/132 100%, Positives = 132/132 100%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 2. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 232.0 bits 855,  Expect = 4e-63
 Identities = 128/131 97%, Positives = 129/131 98%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCDVGDGNT ASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGESGAVI GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 3. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 203.2 bits 746,  Expect = 2e-54
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAY D+HLMC++ +GN  A+AAIIGHDGSVWAQS+ FPQLKPEE+TG+MNDFNE G 
Sbjct  1    MSWQAYGDEHLMCEI-EGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 4. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 203.2 bits 746,  Expect = 2e-54
 Identities = 104/132 78%, Positives = 121/132 91%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVDDHLMCD+ G G   A+A+I+GHDGS+WAQSA+FPQLKPEE+TGIM DF+E G
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL++ GTKYMVIQGESGAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 5. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 202.7 bits 744,  Expect = 3e-54
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMC++ +GN  ++AAIIGHDGSVWAQSA FPQLKPEEVTGI+NDFNE G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG T+KK+  A++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 202.4 bits 743,  Expect = 3e-54
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ +GN   SAAIIG+DGSVWAQSANFPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQTYVDDHLMCDI-EGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE+GAVIRGKKG+GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDY++EQGL
Sbjct  120  ERLGDYIIEQGL 131

Sequence Alignment: 7. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 202.2 bits 742,  Expect = 4e-54
 Identities = 108/132 81%, Positives = 121/132 91%, Gaps = 2/132 1%
Query  1    MSWQAYVDDHLMCDV-G-DGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEA 58
            MSWQAYVDDHLMCD+ G +G+   +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 118
            G LAPTGL LGGTKYMVIQGE+GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  119  VVERLGDYLLEQGL 132
            VVERLGDYLLEQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 8. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 201.9 bits 741,  Expect = 5e-54
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMC++ +GN  ++AAIIGH+GSVWAQSA FPQLKPEEVTGIMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE G VIRGKKG GG T+KK+  A++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 9. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 201.1 bits 738,  Expect = 8e-54
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMC++ +GN   SAAIIG+DGSVWA+S NFPQLKPEE+TGI+NDFNE G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL++GG+KYMVIQGE GAVIRGKKG GG T+KKT  A+VIGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 10. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 200.9 bits 737,  Expect = 1e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+   SAAI+GHDG+VWAQSA FPQ+KPEE+T IM DF+E GF
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 11. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 200.8 bits 737,  Expect = 1e-53
 Identities = 107/132 81%, Positives = 120/132 90%, Gaps = 2/132 1%
Query  1    MSWQAYVDDHLMCDV-G-DGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEA 58
            MSWQAYVDDHLMCD+ G +G+   +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 118
            G LAPTGL LGGTKYMVIQGE+GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  119  VVERLGDYLLEQGL 132
            V ERLGDYLLEQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 12. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 199.8 bits 733,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMCD+ DG+   +AAIIGHDGSVWAQS++FPQ+KPEEV  IM DF+E G 
Sbjct  1    MSWQTYVDEHLMCDI-DGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 13. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 199.5 bits 732,  Expect = 2e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMC++ +G+   SAAIIGHDG+VWAQSA FP +KPEE+  IM DF+E GF
Sbjct  1    MSWQAYVDDHLMCEI-EGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+V+
Sbjct  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVI 119
Query  121  ERLGDYLLEQGL 132
            E+LGDYL+EQG+
Sbjct  120  EKLGDYLIEQGM 131

Sequence Alignment: 14. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 199.3 bits 731,  Expect = 3e-53
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+  ASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTG+F+ G KYMVIQGE GAVIRGKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 15. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 199.0 bits 730,  Expect = 3e-53
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ Y D+HLMC++ +GN  A+AAIIGHDGSVWAQS+ FPQLKPEE+TG+MNDFNE G 
Sbjct  1    MSWQTYGDEHLMCEI-EGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GAVIR KKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 16. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 198.8 bits 729,  Expect = 4e-53
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMC++ +GN   SAAIIG+DGSVWAQSA FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQTYVDDHLMCEI-EGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE+GAVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQ L
Sbjct  120  ERLGDYLIEQSL 131

Sequence Alignment: 17. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 198.2 bits 727,  Expect = 6e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 4/131 3%
Query  1    MSWQAYVDDHLMCDVGDGNTP---ASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE 57
            MSWQAYVDDHLMCD+ +G+      +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE
Sbjct  1    MSWQAYVDDHLMCDI-EGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNE 59
Query  58   AGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCN 117
             G LAPTGL LGGTKYMVIQGE+GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN
Sbjct  60   PGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCN 119
Query  118  LVVERLGDYLLEQGL 132
            +VVERLGDYL+EQG+
Sbjct  120  MVVERLGDYLVEQGM 134

Sequence Alignment: 18. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 197.7 bits 725,  Expect = 9e-53
 Identities = 102/130 78%, Positives = 121/130 93%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMC++ +GN  ++AAIIG+DGSVWAQSANFPQ+K EE+TGIM+DF+E G 
Sbjct  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL++GGTKYMVIQGE GAVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 19. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 197.4 bits 724,  Expect = 1e-52
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHL+CD+ +G   ++AAI+GHDGSVWAQS NFP+LKPEEV G++ DF+E G 
Sbjct  1    MSWQAYVDDHLLCDI-EGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLF+GGTKYMVIQGE G VIRGKKG+GG T+KKTG +++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGF 131

Sequence Alignment: 20. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 197.4 bits 724,  Expect = 1e-52
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+  ASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTG+F+ G KYMVIQGE G VIRGKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 21. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 197.4 bits 724,  Expect = 1e-52
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+  ASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTG+F+ G KYMVIQGE G VIRGKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 22. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 197.4 bits 724,  Expect = 1e-52
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE+GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 23. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 197.4 bits 724,  Expect = 1e-52
 Identities = 103/132 78%, Positives = 119/132 90%, Gaps = 2/132 1%
Query  1    MSWQAYVDDHLMCDV-GD-GNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEA 58
            MSWQAYVDDHLMC+V G+ G T  +AAIIGHDGSVWAQS+ FPQ+KPEE+ GIM DF+E 
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  59   GFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 118
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG T+KKTGQA+V G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  119  VVERLGDYLLEQGL 132
            +VERLGDYL++QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 24. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 197.2 bits 723,  Expect = 1e-52
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHL+CD+ +GN    AAIIG+DGSVWAQS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLLCDI-EGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQG 131
            ER GDYL++QG
Sbjct  120  ERPGDYLIDQG 130

Sequence Alignment: 25. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 197.2 bits 723,  Expect = 1e-52
 Identities = 105/131 80%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCDV +GN   +AAI+G+DGSVWAQSANFPQLKPEE+ GI NDF E G 
Sbjct  1    MSWQTYVDDHLMCDV-EGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLF+GGTKYMVIQGE  AVIRGKKG+GG T+KKT QA V GIY+EPMTPGQCN+VV
Sbjct  60   LAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 26. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 197.2 bits 723,  Expect = 1e-52
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ DG+   +AAIIGHDGSVWAQS+ FPQ+K +EV  +M DF+E G 
Sbjct  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 27. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 197.2 bits 723,  Expect = 1e-52
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ +GNT  SAAIIGHDGSVWA SA+FPQ+  EEV+ IM DF E G 
Sbjct  1    MSWQVYVDDHLMCDI-EGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE GAVIRGKKGSGG T+KKT QA++IG+YDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 28. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 196.9 bits 722,  Expect = 1e-52
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+  +SAAI+GHDG+VWAQS  FPQ+KPEE+T I+ DF+E GF
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAP GLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+VV
Sbjct  60   LAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 29. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 196.9 bits 722,  Expect = 1e-52
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ DG+   +AAIIGHDGSVWAQS++FPQ+K +EV  +M DF+E G 
Sbjct  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLL+QGL
Sbjct  120  ERLGDYLLDQGL 131

Sequence Alignment: 30. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 196.1 bits 719,  Expect = 3e-52
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA+FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN+VV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 196.1 bits 719,  Expect = 3e-52
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 4/131 3%
Query  1    MSWQAYVDDHLMCDVGDGNTP---ASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE 57
            MSWQ YVDDHLMC+V DGN     ++AAIIGHDGSVWAQS+ FP++KPEE+TGIM +F+E
Sbjct  1    MSWQTYVDDHLMCEV-DGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDE 59
Query  58   AGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCN 117
             G LAPTGL+LGGTKYMVIQGE  AVIRGKKGSGG T+KKTGQA+V G+YDEP+TPGQCN
Sbjct  60   PGHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCN 119
Query  118  LVVERLGDYLLEQGL 132
            L+VERLGDYL+EQGL
Sbjct  120  LIVERLGDYLIEQGL 134

Sequence Alignment: 32. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 195.9 bits 718,  Expect = 3e-52
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQQYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE+GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 195.9 bits 718,  Expect = 3e-52
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA FP +KPEE+  I+ DF++ G 
Sbjct  1    MSWQQYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE+GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 34. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 195.9 bits 718,  Expect = 3e-52
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCD+ DG+   +AAI+GHDGSVWAQS+ FP++KPEE+T IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDI-DGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKT QA+V GIY+EP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 195.9 bits 718,  Expect = 3e-52
 Identities = 101/130 77%, Positives = 115/130 88%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSW+AYVDDHL C++ DG    SAAI+GHDGSVWAQS NFPQ+KPEE+ GI+ DF E G 
Sbjct  1    MSWKAYVDDHLCCEI-DGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 36. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 195.6 bits 717,  Expect = 4e-52
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA FP +KPEE+  I+ D+++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE+GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 195.6 bits 717,  Expect = 4e-52
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ +GN  +SAAI+GHDG+VWAQS +FPQLKPEEV+ IM DFNE G 
Sbjct  1    MSWQTYVDDHLMCDI-EGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE G VIRGKKG GG T+KKT QA++IGIY EPMTPGQCN+VV
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ER+GDYL+EQG+
Sbjct  120  ERIGDYLVEQGM 131

Sequence Alignment: 38. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 195.3 bits 716,  Expect = 4e-52
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ DG    +AAIIGHDGSVWAQS++FPQ+KPEE+  IM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-DGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE+GAVIRGKKG+GG T+KKTGQA++ GIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLVEQGL 131

Sequence Alignment: 39. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 195.3 bits 716,  Expect = 4e-52
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHL+C + +GN    AAIIG+DGSVW QS +FPQ+KPEE+T IMNDFNE G 
Sbjct  1    MSWQAYVDDHLLCGI-EGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GAVIRGKKG GG T+KKTG A++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 195.3 bits 716,  Expect = 4e-52
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +GN   SAAIIG+DGSVWAQS NFPQLKPEEV GI+ DF + G 
Sbjct  1    MSWQVYVDEHLMCEI-EGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL++GGTKYMVIQGE GAVIRGKKG GG T+KKTG A+VIGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 41. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 195.1 bits 715,  Expect = 5e-52
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVD+HLMC++ DG+   +AAI+GHDGSVWAQS++FPQ+K EE+T IMNDFNE G 
Sbjct  1    MSWQAYVDEHLMCEI-DGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LG TKYMVIQGE GAVIRGKKGSGG T+KKT QA++ GIY+EPMTPGQCN+VV
Sbjct  60   LAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGM 131

Sequence Alignment: 42. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 194.8 bits 714,  Expect = 6e-52
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+  ASAAI GHDG+VWAQSA+FPQ+KPEE+TGIM D++E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTG+F+   KYMVIQGE GAVIRGKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGM 131

Sequence Alignment: 43. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 194.5 bits 713,  Expect = 8e-52
 Identities = 103/131 78%, Positives = 114/131 87%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMC+  DG    +AAIIGHDGSVWAQSANFPQ+KP E+  IM DF+E G 
Sbjct  1    MSWQTYVDDHLMCET-DGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLVDQGL 131

Sequence Alignment: 44. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 194.5 bits 713,  Expect = 9e-52
 Identities = 101/130 77%, Positives = 114/130 87%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSW+AYVDDHL C++ DG    SAAI+GHDGSVWAQS NFPQ+KPEE  GI+ DF E G 
Sbjct  1    MSWKAYVDDHLCCEI-DGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 45. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 194.5 bits 713,  Expect = 9e-52
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHL C++ DG    SAAI+GHDGSVWA+S NFP++KPEE+ GI+ DF E G 
Sbjct  1    MSWQAYVDDHLCCEI-DGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 46. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 194.3 bits 712,  Expect = 9e-52
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVD+HLMC++ +G   ++AAI+GHDGSVWAQS +FP+LKPEEV GI+ DF+E G 
Sbjct  1    MSWQAYVDEHLMCEI-EGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLF+GGTKYMVIQGE G VIRGKKG+GG T+KKTG +++IG+YDEPMTPGQCN+VV
Sbjct  60   LAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLIEQGF 131

Sequence Alignment: 47. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 194.3 bits 712,  Expect = 9e-52
 Identities = 99/132 75%, Positives = 118/132 89%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVD+HLMCD+ G  +   ++AI+GHDGSVWAQS++FPQ+KP+E+TGIM DF E G
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGG KYMVIQGE+GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL++QGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 48. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 194.0 bits 711,  Expect = 1e-51
 Identities = 102/132 77%, Positives = 117/132 88%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVD+HLMCD+ G G   A+AAIIGHDGSVWAQS+NFPQ+K EE++ IM DF E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGGTKYMVIQGE+GAVIRGKKGSGG T+KKT QA+V GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 49. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 193.7 bits 710,  Expect = 1e-51
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDD LMCD+ DG+   +AAI+GHDGSVWA+S+ FP++KPEE+T IM DF+E G 
Sbjct  1    MSWQAYVDDRLMCDI-DGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQA+V GIY+EP+TPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QGL
Sbjct  120  ERLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 193.7 bits 710,  Expect = 1e-51
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMC++ DG   +SAAI+GHD +VWAQS NFPQ+KPEE++ I+NDF   G 
Sbjct  1    MSWQAYVDDHLMCEI-DGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE G VIRGKKG+GG T+KKT  A++IG+YDEPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGF 131

Sequence Alignment: 51. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 193.5 bits 709,  Expect = 2e-51
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMC++ +G+   SAAI+GHDG+ WAQS  FP++KPEE+  IM DF+E G 
Sbjct  1    MSWQTYVDEHLMCEI-EGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE GAVIRGKKGSGG T+KKTGQ+++IGIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 52. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 193.5 bits 709,  Expect = 2e-51
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMCD+ DG+   +AAIIGHDGSVWAQS++FPQ+K +EV  IM DF+E G 
Sbjct  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LG TKYMVIQGE GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 53. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 193.5 bits 709,  Expect = 2e-51
 Identities = 100/131 76%, Positives = 115/131 87%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHL+CD+ DG    +AAI+GHDGSVWAQS  FPQ KPEE+  IM DF+E G 
Sbjct  1    MSWQAYVDDHLLCDI-DGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GAVIRGKKGSGG T+KKT  A++IGIY+EPMTPGQCN+VV
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++QG+
Sbjct  120  ERLGDYLFDQGF 131

Sequence Alignment: 54. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 193.2 bits 708,  Expect = 2e-51
 Identities = 99/131 75%, Positives = 113/131 86%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHL C++ DG    SAAI+GHDG VW QS NFPQ+KPEE+ GI+ DF+E G 
Sbjct  1    MSWQTYVDDHLCCEI-DGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG  +++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLVEQGF 131

Sequence Alignment: 55. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 192.4 bits 705,  Expect = 3e-51
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HL+C+  +GN   SAAIIG+DG+VWAQSANFPQ+KPEE+TGIMNDF   G 
Sbjct  1    MSWQTYVDEHLLCE-NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE  AVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQ L
Sbjct  120  ERLGDYLIEQSL 131

Sequence Alignment: 56. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 192.4 bits 705,  Expect = 3e-51
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HL+C+  +GN   SAAIIG+DG+VWAQSANFPQ+KPEE+TGIMNDF   G 
Sbjct  1    MSWQTYVDEHLLCE-NEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE  AVIRGKKG GG T+KKT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQ L
Sbjct  120  ERLGDYLIEQSL 131

Sequence Alignment: 57. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 191.9 bits 703,  Expect = 5e-51
 Identities = 98/130 75%, Positives = 113/130 86%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHL C++ DG    SAAI+GHDGSVW +S NFP++KPEE+ GI+ DF E G 
Sbjct  1    MSWQTYVDDHLCCEI-DGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG A+++GIYDEPMTPGQCNLVV
Sbjct  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL++QG
Sbjct  120  ERLGDYLIDQG 130

Sequence Alignment: 58. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 191.4 bits 701,  Expect = 7e-51
 Identities = 98/131 74%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVDDHLMCD+ DGN   +AAI+G+DGSVW+QSA FP ++ EE+  I+ DF++ G 
Sbjct  1    MSWQAYVDDHLMCDI-DGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGGTKYMVIQGE+GAVIRGKKGSGG  +KKT QA++IGIYDEP+TPGQCN++V
Sbjct  60   LAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+EQGL
Sbjct  120  ERLGDYLIEQGL 131

Sequence Alignment: 59. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 191.1 bits 700,  Expect = 8e-51
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQAYVD+HLMC++ +G+  A+AAI+GHDG+ WAQS  FP++K E++  IM DF+E G 
Sbjct  1    MSWQAYVDEHLMCEI-EGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGH 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 60. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 190.8 bits 699,  Expect = 1e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+ LMC++ +GN   +AAIIG+DGSVWAQS+NFPQ+K EE+T IM+DF+E G 
Sbjct  1    MSWQTYVDERLMCEI-EGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL LGGTKYMVIQGE+GAVIRGKKG GG T++KT QA++IGIYDEPMTPGQCN++V
Sbjct  60   LAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYLLEQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 61. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 190.8 bits 699,  Expect = 1e-50
 Identities = 97/130 74%, Positives = 113/130 86%, Gaps = 1/130 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HLMCD+ DG+   SAAI+GHDGSVWAQSA FP+LKP E+T I+NDFNE G 
Sbjct  1    MSWQTYVDEHLMCDM-DGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTG+++ G KYMVIQGE G VIRGKKGSGG T+KK+  A++ G+YDEPMTPGQCNLVV
Sbjct  60   LAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVV 119
Query  121  ERLGDYLLEQG 131
            ERLGDYL+EQG
Sbjct  120  ERLGDYLIEQG 130

Sequence Alignment: 62. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 190.8 bits 699,  Expect = 1e-50
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 4/131 3%
Query  1    MSWQAYVDDHLMCDVGDGNTP---ASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNE 57
            MSWQAYVDDHLMCD+ +G+      +AAI+GHDGSVWAQSA FPQ+KPEE+ GIM DFNE
Sbjct  1    MSWQAYVDDHLMCDI-EGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNE 59
Query  58   AGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCN 117
             G LAPTGL LGGTKYMVIQGE+GAVIRGKKGSGG T+KKT QA+V GIY+EP+TPGQCN
Sbjct  60   PGTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCN 119
Query  118  LVVERLGDYLLEQGL 132
            +VV RLGD L++QG+
Sbjct  120  MVVWRLGDRLVQQGM 134

Sequence Alignment: 63. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 190.3 bits 697,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 112/131 85%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ+YVDDHLMCDV +GN   +AAI+G+DGSVWAQSA FPQLKP+E+ GI  DF E GF
Sbjct  1    MSWQSYVDDHLMCDV-EGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGF 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGLFLGG KYMVIQGE GAVIRGKKG GG T+KKT QA+V G YDEPMT GQCNLVV
Sbjct  60   LAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL+E  L
Sbjct  120  ERLGDYLIESEL 131

Sequence Alignment: 64. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 189.3 bits 693,  Expect = 3e-50
 Identities = 96/132 72%, Positives = 116/132 87%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQAYVD+HLMCD+ G G    SAAI+G DG+VWAQSA FPQ+KPEE+ GI+ +F+EAG
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTG+F+ G KYMV+QGE GAVIRGKKG+GG  +KKTGQA+++GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYLLEQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 65. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 188.7 bits 691,  Expect = 4e-50
 Identities = 98/132 74%, Positives = 114/132 86%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVD+HLMCD+ G G    +AAIIGHDGS+WAQS++FPQLK +E+T I  DF E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL L GTKYMVIQGE GAVIRGKKGSGG T+KKTGQA++ GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 66. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 188.7 bits 691,  Expect = 4e-50
 Identities = 98/131 74%, Positives = 115/131 87%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQAYVDDHLMC++ G  N    AAI+G DGSVWAQSA+FPQ+KP+E+  I+ DF+E G
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGGTKYMVIQGE GAVIRGKKG+GG  +KKTGQA+V+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  120  VERLGDYLLEQG 131
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 67. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 188.2 bits 689,  Expect = 6e-50
 Identities = 97/132 73%, Positives = 114/132 86%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVDDHLMCD+ G G    SAAI G DG+VWA+SA+FP++KP E+  I+ +FNEAG
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGLFLGG KYMVIQGE+GAVIRGKKG+GG  +KKTGQA+V GIYDEP+ PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYLL+QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 68. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 187.7 bits 687,  Expect = 9e-50
 Identities = 95/132 71%, Positives = 116/132 87%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVDDHLMC++ G  N   +AAI+G DGSVWAQSANFPQ+KP+E++ ++ +F+EAG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGGTKYMVIQGE+G VIRGKKG GG  +KKTGQA++ GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 69. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 186.6 bits 683,  Expect = 2e-49
 Identities = 96/132 72%, Positives = 113/132 85%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVDDHLMCD+ G  N    AAI+G DGSVWAQSANFPQ+KP+E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGGTKYMVIQGE+G VIRGKKG GG  +KKTGQA++ GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 70. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 185.6 bits 679,  Expect = 4e-49
 Identities = 93/132 70%, Positives = 115/132 87%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVDDHLMCD+ G G    +AAI+G DG+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGLFLGG KYMV+QGE+GAVIRGKKG+GG  +KKTGQA+V+GIYDEP+ PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL++Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 71. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 185.0 bits 677,  Expect = 6e-49
 Identities = 93/131 70%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVD+HL+C++ +G+  +SAAI+G+DG VWAQS++FPQ+KPEE+T IMNDF E G 
Sbjct  1    MSWQTYVDNHLLCEI-EGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGS 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
            LAPTGL+LGGTKYMVIQGE GA+I GKKG GG T++KT QA++IGIYD+PMTPGQCN++V
Sbjct  60   LAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIV 119
Query  121  ERLGDYLLEQGL 132
            ERLGDYL++ GL
Sbjct  120  ERLGDYLIDTGL 131

Sequence Alignment: 72. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 184.8 bits 676,  Expect = 7e-49
 Identities = 94/132 71%, Positives = 115/132 87%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQ YVDDHLMC++ G  N  ++AAI+G DGSVWAQSA+FPQ+KP+E++ ++ DF+  G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGGTKYMVIQGE G VIRGKKG GG  +KKTGQA++IGIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 180.3 bits 659,  Expect = 2e-47
 Identities = 93/132 70%, Positives = 111/132 84%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDVGD-GNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            MSWQAYVD+HLMC++ D GN   S+AI+G DGS+WAQS+NFPQ+KP+E+  I  +F+   
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGLFLGG KYMVIQGE GAVIRGKKG GG  +KKT QA++ GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL+EQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 74. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 179.5 bits 656,  Expect = 3e-47
 Identities = 92/132 69%, Positives = 110/132 83%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
            M WQ YVDDHLMC++ G  N  + AAI+G DGSVWAQSA+FPQ+KP+E+  ++ DF+  G
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
             LAPTGL LGGTKYMVIQGE G  IRGKKG GG  +KKTGQA+V GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  120  VERLGDYLLEQGL 132
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 163.6 bits 595,  Expect = 1e-42
 Identities = 85/109 77%, Positives = 99/109 90%, Gaps = 1/109 0%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
            MSWQ YVDDHLMC++ +GN   SAAIIG+DGS+WAQSA+FPQ+KPEE+T IMNDF+E G 
Sbjct  1    MSWQTYVDDHLMCEI-EGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGT 59
Query  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEP 110
            LAPTGL+LGGTKYMVIQGE+GAVIRGKKG GG T+KKT QA++IGIYDEP
Sbjct  60   LAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 136.9 bits 495,  Expect = 2e-34
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 29/130 22%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQ------------------ 42
            MSWQ YVDDHLMCD+ +G+  ASAAI+G DGSVWAQS  FP+                  
Sbjct  1    MSWQTYVDDHLMCDL-EGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYI 59
Query  43   ----------LKPEEVTGIMNDFNEAGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGG 92
                      +KPEE+T IM DF+E GFLAPTGLFLGGTKYMVIQGE GAVIRGKKGS G
Sbjct  60   MRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSG 119
Query  93   ATLKKTGQAIVIGIYDEPMTPGQCNLVVERLGDYLLEQG 131
             T+KKTGQA++ GIY+EP+TPGQCN+VVE++GDYL++QG
Sbjct  120  ITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 71.2 bits 245,  Expect = 1e-14
 Identities = 50/121 41%, Positives = 76/121 62%, Gaps = 11/121 9%
Query  1    MSWQAYVDDHLMCDVGDGNTPASAAIIG-HDGSVWAQ-SANFP-QLKPEEVTGIMNDF-- 55
            MSWQ+YVD+++ C   D      A I G +DG+VWA+   ++P Q+  +E+  I +    
Sbjct  1    MSWQSYVDNQI-CQHVDCRL---AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRS 56
Query  56   NEAGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQ 115
            N   FL   G+ LGG KY+ IQ ++ +++RG+KGS    +  T   ++     +   PGQ
Sbjct  57   NPNSFLEG-GIHLGGEKYICIQADN-SLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  116  CNLVVERLGDYL 127
             N VVE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.