The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE
KLGDYLIEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
O04725 Cyn d 12 131 901 278.1 5.4e-77
Q9FUD1 Ory s 12.0101 131 867 267.8 6.8e-74
P35083 Zea m 12.0103 131 844 260.8 8.5e-72
P35082 Zea m 12.0102 131 831 256.9 1.3e-70
P35081 Zea m 12.0101 131 814 251.7 4.6e-69
Q9M7N0 Hev b 8.0201 131 801 247.8 7.1e-68
O24650 Phl p 12.0102 131 800 247.5 8.7e-68
P35079 Phl p 12.0101 131 793 245.4 3.8e-67
CAA54686 Phl p 12.0101 131 793 245.4 3.8e-67
O24282 Phl p 12.0103 131 792 245.1 4.7e-67
Q8L5D8 Pho d 2.0101 131 784 242.7 2.5e-66
Q9M7M8 Hev b 8.0203 131 780 241.4 5.8e-66
A0A2I4DNN6 Jug r 7.0101 131 775 239.9 1.7e-65
Q9M7M9 Hev b 8.0202 131 775 239.9 1.7e-65
AAL07320 Lit c 1 131 775 239.9 1.7e-65
O22655 Zea m 12.0104 131 774 239.6 2e-65
Q9LEI8 Hev b 8.0204 131 773 239.3 2.5e-65
Q9XF42 Mal d 4 131 771 238.7 3.8e-65
Q9XF38 Pyr c 4 131 770 238.4 4.7e-65
CAD37201 Pru p 4.0101 131 769 238.1 5.9e-65
Q9FR39 Zea m 12.0105 131 768 237.8 7.2e-65
FM164277 Tri a 12.0104 131 765 236.9 1.4e-64
P49233 Tri a 12.0102 141 765 236.9 1.5e-64
AY081852 Pru du 4.0102 131 763 236.3 2.1e-64
AY081850 Pru du 4.0101 131 763 236.3 2.1e-64
Q9XF39 Pru av 4 131 762 236.0 2.5e-64
Q9XF40 Mal d 4 131 762 236.0 2.5e-64
CAD37202 Pru p 4.0201 131 761 235.7 3.1e-64
P52184 Hor v 12.0101 131 761 235.7 3.1e-64
O24169 Ole e 2 134 761 235.7 3.2e-64
AAL92870 Che a 2 131 758 234.8 5.9e-64
Q9XF41 Mal d 4 131 758 234.8 5.9e-64
Q9STB6 Hev b 8.0102 131 758 234.8 5.9e-64
QID21357 Pop n 2.0101 131 757 234.5 7.3e-64
AAL29690 Lyc e 1 131 757 234.5 7.3e-64
O24170 Ole e 2 134 755 233.9 1.1e-63
P49232 Tri a 12.0101 138 755 233.8 1.2e-63
Q5XWE1 Citr l 2.0101 131 753 233.3 1.7e-63
O65809 Gly m 3 131 752 233.0 2.1e-63
P49234 Tri a 12.0103 140 752 232.9 2.3e-63
AF377948 Mus a 1.0101 131 751 232.7 2.6e-63
Q9XF37 Api g 4 134 751 232.6 2.6e-63
CAD10376 Cap a 2 131 750 232.4 3.2e-63
ACP43298 Ama r 2.0101 133 750 232.3 3.2e-63
O24171 Ole e 2 134 750 232.3 3.3e-63
O65810 Gly m 3 131 749 232.1 3.9e-63
AAP13533 Cuc m 2 131 748 231.8 4.8e-63
AAK54835 Ana c 1 131 748 231.8 4.8e-63
Q9AXH4 Cor a 2 131 748 231.8 4.8e-63
P84177 Cit s 2.0101 131 746 231.1 7.3e-63
AAL76933 Dau c 4 134 746 231.1 7.6e-63
O49894 Mer a 1 133 743 230.2 1.4e-62
O65812 Hev b 8.0101 131 736 228.1 6e-62
A0A023W2L7 Pro j 2.0101 133 736 228.1 6.1e-62
CAD10377 Lyc e 1 131 735 227.8 7.4e-62
Q93YG7 Sola l 1.0101 131 735 227.8 7.4e-62
AAK01235 Cor a 2 131 732 226.9 1.4e-61
Q9XG85 Par j 3 132 732 226.9 1.4e-61
O81982 Hel a 2 133 726 225.1 5e-61
Q9T0M8 Par j 3 131 725 224.8 6e-61
QRN65366 Lig v 2.0101 134 725 224.8 6.2e-61
A0A0A0REA1 Koc s 2.0101 133 724 224.5 7.6e-61
A0A0A0RCW1 Aca f 2 133 722 223.9 1.2e-60
ABU95412 Sin a 4.0101 131 720 223.3 1.7e-60
QVU02258 Que ac 2.0101 133 720 223.3 1.8e-60
Q9SQI9 Ara h 5 131 717 222.4 3.2e-60
XP030492464 Can s 2.0101 133 716 222.0 4.1e-60
ACS34771 Sal k 4.0101 133 713 221.1 7.6e-60
Q42449 Ara t 8 131 711 220.5 1.1e-59
Q5EF31 Cro s 1.0101 131 707 219.3 2.6e-59
P25816 Bet v 2 133 707 219.3 2.7e-59
AJ421030 Art v 4.0101 133 702 217.8 7.7e-59
AJ421031 Art v 4.0201 133 689 213.9 1.2e-57
ADK22841 Sal k 4.0201 133 687 213.3 1.8e-57
FG438715 Act d 9.0101 109 619 192.8 2.1e-51
QEQ43417 Sola m 1.0101 159 543 169.5 3.1e-44
A0A1B2YLJ4 Tyr p 36.0101 131 237 77.0 1.9e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 278.1 bits 901,  Expect = 5e-77
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  KLGDYLIEQGM 131
            KLGDYLIEQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 2. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 267.8 bits 867,  Expect = 7e-74
 Identities = 120/131 91%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHLTSAAI+GHDGTVWAQSAAFP FKPEEM NIMKDFDEPGFL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGG+TVKKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 3. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 260.8 bits 844,  Expect = 8e-72
 Identities = 116/131 88%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHL+SAAI+GHDG VWAQS AFP FKPEEM NI+KDFDEPGFL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            AP GLFLGPTKYMVIQGEPGAVIRGKKGSGG+TVKKTGQALVIGIYDEPMTPGQCNMV+E
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 4. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 256.9 bits 831,  Expect = 1e-70
 Identities = 115/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVD+HLMCEIEGHHL +AAI+GHDG  WAQS AFP FK E+MANIMKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGG+TVKKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 5. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 251.7 bits 814,  Expect = 5e-69
 Identities = 113/131 86%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHLTSAAI+GHDG  WAQS AFP FKPEEMA IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKTGQ+L+IGIYDEPMTPGQCN+V+E
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 247.8 bits 801,  Expect = 7e-68
 Identities = 110/131 83%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMC+I+GHHLT+AAIIGHDG+VWAQS++FP FKPEE+A IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKTGQAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 247.5 bits 800,  Expect = 9e-68
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHL SAAI+GHDGTVWAQSA FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GG+T+KKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 8. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 245.4 bits 793,  Expect = 4e-67
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHL SAAI+GHDGTVWAQSA FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTG+F+   KYMVIQGEPG VIRGKKG+GG+T+KKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 9. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 245.4 bits 793,  Expect = 4e-67
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHL SAAI+GHDGTVWAQSA FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTG+F+   KYMVIQGEPG VIRGKKG+GG+T+KKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 10. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 245.1 bits 792,  Expect = 5e-67
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHL SAAI GHDGTVWAQSA FP FKPEE+  IMKD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GG+T+KKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 11. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 242.7 bits 784,  Expect = 3e-66
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVD+HLMCEI+GHHLT+AAI+GHDG+VWAQS++FP FK EE+ NIM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGGVTVKKT QAL+ GIY+EPMTPGQCNMV+E
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 12. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 241.4 bits 780,  Expect = 6e-66
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+I+GH LT+AAIIGHDG+VWAQS+ FP FK +E+A +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKTGQAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 13. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 239.9 bits 775,  Expect = 2e-65
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEI+G+HLT+AAIIGHDG+VWAQS++FP FKPEE+A IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGE GAVIRGKKG+GG+TVKKTGQAL+ GIYDEP+TPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 14. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 239.9 bits 775,  Expect = 2e-65
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+I+GH LT+AAIIGHDG+VWAQS++FP FK +E+A IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 15. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 239.9 bits 775,  Expect = 2e-65
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMCE +G+HLT+AAIIGHDG+VWAQSA FP FKP E+A IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 16. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 239.6 bits 774,  Expect = 2e-65
 Identities = 104/130 80%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVD+HLMCEIEG+HL++AAI+GHDG+VWAQS +FP +KPEE+A I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GG+T+KKTG +L+IG+YDEPMTPGQCNMV+E
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 17. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 239.3 bits 773,  Expect = 3e-65
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+I+GH LT+AAIIGHDG+VWAQS++FP FK +E+A +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKTGQAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL++QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 18. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 238.7 bits 771,  Expect = 4e-65
 Identities = 106/131 80%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA+FPAFKPEE+A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGG+T+KKT QAL+IGIYDEP+TPGQCN+V+E
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 19. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 238.4 bits 770,  Expect = 5e-65
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMC+I+GHHLT+AAI+GHDG+VWAQS+ FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGVTVKKT QALV GIY+EP+TPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 20. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 238.1 bits 769,  Expect = 6e-65
 Identities = 106/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA FPAFKPEE+A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 21. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 237.8 bits 768,  Expect = 7e-65
 Identities = 103/130 79%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHL+C+IEG+HL++AAI+GHDG+VWAQS  FP +KPEE+A ++KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GG+T+KKTG +L+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 22. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 236.9 bits 765,  Expect = 1e-64
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSW+AYVDDHL CEI+G+HLTSAAI+GHDG+VWAQS  FP FKPEE+A I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG AL++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 23. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 236.9 bits 765,  Expect = 2e-64
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHL CEI+G+HLTSAAI+GHDG+VWA+S  FP FKPEE+A I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG AL++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 24. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 236.3 bits 763,  Expect = 2e-64
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA FPAFKPEE+A I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 25. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 236.3 bits 763,  Expect = 2e-64
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA FPAFKPEE+A I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 26. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 236.0 bits 762,  Expect = 3e-64
 Identities = 105/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA FPAFKPEE+A I+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 27. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 236.0 bits 762,  Expect = 3e-64
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDD LMC+I+GHHLT+AAI+GHDG+VWA+S+ FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGVTVKKTGQALV GIY+EP+TPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 28. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 235.7 bits 761,  Expect = 3e-64
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMCEIEG+HL++AAIIGHDG+VWAQSA FP +KPEE+  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GGVTVKK+  AL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 29. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 235.7 bits 761,  Expect = 3e-64
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHL CEI+G+HLTSAAI+GHDG VW QS  FP FKPEE+A I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG  L++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 30. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 235.7 bits 761,  Expect = 3e-64
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGHH---LTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
            MSWQAYVDDHLMC+IEGH    LT+AAI+GHDG+VWAQSA FP FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VIEKLGDYLIEQGM 131
            V+E+LGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 31. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 234.8 bits 758,  Expect = 6e-64
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+IEG+HL+SAAI+GHDGTVWAQS +FP +KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGEPG VIRGKKG GGVT+KKT QAL+IGIY EPMTPGQCNMV+E
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            ++GDYL+EQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 32. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 234.8 bits 758,  Expect = 6e-64
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMCEIEG+HL++AAIIGH+G+VWAQSA FP +KPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GGVTVKK+  AL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 234.8 bits 758,  Expect = 6e-64
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMCEIEG+HL++AAIIG+DG+VWAQSA FP FK EE+  IM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GGVTVKKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 34. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 234.5 bits 757,  Expect = 7e-64
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+IEG+ LTSAAIIGHDG+VWA SA+FP F  EE++ IMKDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGGVTVKKT QAL+IG+YDEP+TPGQCNM++E
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 234.5 bits 757,  Expect = 7e-64
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC+IEG+HLTSAAIIG+DG+VWAQSA FP FKPEE+  IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGE GAVIRGKKG+GG+TVKKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDY+IEQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 36. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 233.9 bits 755,  Expect = 1e-63
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGHH---LTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
            MSWQAYVDDHLMC+IEGH    LT+AAI+GHDG+VWAQSA FP FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VIEKLGDYLIEQGM 131
            V+E+LGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 37. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 233.8 bits 755,  Expect = 1e-63
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHL CEI+G+HLTSAAI+GHDG+VW +S  FP FKPEE+A I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG AL++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 38. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 233.3 bits 753,  Expect = 2e-63
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMCEIEG+HLTSAAIIG+DG+VWA+S  FP +KPEE+  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL++G +KYMVIQGEPGAVIRGKKG GGVTVKKT  ALVIGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 39. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 233.0 bits 752,  Expect = 2e-63
 Identities = 106/130 81%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHL+C+IEG+HLT AAIIG+DG+VWAQS  FP FKPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GGVTVKKTG AL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQG 130
            + GDYLI+QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 40. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 232.9 bits 752,  Expect = 2e-63
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSW+AYVDDHL CEI+G++LTSAAI+GHDG+VWAQS  FP FKPEE A I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG AL++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 41. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 232.7 bits 751,  Expect = 3e-63
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHL+C+I+G+ LT+AAI+GHDG+VWAQS AFP  KPEE+A IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGGVT+KKT  AL+IGIY+EPMTPGQCNMV+E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYL +QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 42. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 232.6 bits 751,  Expect = 3e-63
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGHH---LTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
            MSWQAYVDDHLMCE+EG+    LT+AAIIGHDG+VWAQS+ FP  KPEE+A IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAPTGL+LG  KYMVIQGEP AVIRGKKGSGGVT+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VIEKLGDYLIEQGM 131
            ++E+LGDYLI+QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 43. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 232.4 bits 750,  Expect = 3e-63
 Identities = 106/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMCEIEG+ LTSAAIIG+DG+VWAQSA FP FKPEE+  IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GG+TVKKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 44. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 232.3 bits 750,  Expect = 3e-63
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQAYVDDHLMCEIEG  +HLT AAI+G DG+VWAQSA FP FKP+E+A I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPGAVIRGKKG+GG+ VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  IEKLGDYLIEQG 130
            +E+LGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 45. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 232.3 bits 750,  Expect = 3e-63
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGHH---LTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
            MSWQAYVDDHLMC+IEGH    LT+AAI+GHDG+VWAQSA FP FKPEEM  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VIEKLGDYLIEQGM 131
            V E+LGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 46. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 232.1 bits 749,  Expect = 4e-63
 Identities = 106/130 81%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHL+C IEG+HLT AAIIG+DG+VW QS  FP FKPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GGVTVKKTG AL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 47. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 231.8 bits 748,  Expect = 5e-63
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HLTSAAIIG+DG+VWAQS  FP +KPEE+A I+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GGVTVKKTG ALVIGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 48. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 231.8 bits 748,  Expect = 5e-63
 Identities = 102/130 78%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMCEI+G+HL+SAAI+GHD TVWAQS  FP FKPEE++ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+TVKKT  AL+IG+YDEPMTPGQCNMV+E
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 49. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 231.8 bits 748,  Expect = 5e-63
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAY D+HLMCEIEG+ L +AAIIGHDG+VWAQS+ FP +KPEE+  +M DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GGVTVKKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 231.1 bits 746,  Expect = 7e-63
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQAYVDDHLMC+I+G+ LT+AAI+G+DG+VW+QSA FPAF+ EE+A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGG+ VKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 51. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 231.1 bits 746,  Expect = 8e-63
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGH---HLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
            MSWQ YVDDHLMCE++G+   +L++AAIIGHDG+VWAQS+ FP FKPEE+  IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAPTGL+LG TKYMVIQGEP AVIRGKKGSGGVT+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VIEKLGDYLIEQGM 131
            ++E+LGDYLIEQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 52. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 230.2 bits 743,  Expect = 1e-62
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGH--HLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVDDHLMC+I+G+  HL +A+I+GHDG++WAQSA+FP +KPEE+  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL++  TKYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYLIEQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 53. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 228.1 bits 736,  Expect = 6e-62
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+ LMCEIEG+HLT+AAIIG+DG+VWAQS+ FP FK EE+  IM DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL LG TKYMVIQGE GAVIRGKKG GGVTV+KT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 54. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 228.1 bits 736,  Expect = 6e-62
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVDDHLMCEIEG  +HL++AAI+G DG+VWAQSA+FP FKP+E++ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPG VIRGKKG GG+ VKKTGQAL+IGIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 55. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 227.8 bits 735,  Expect = 7e-62
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HL+CE EG+HLTSAAIIG+DGTVWAQSA FP FKPEE+  IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GG+T+KKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 56. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 227.8 bits 735,  Expect = 7e-62
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HL+CE EG+HLTSAAIIG+DGTVWAQSA FP FKPEE+  IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GG+T+KKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 57. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 226.9 bits 732,  Expect = 1e-61
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ Y D+HLMCEIEG+ L +AAIIGHDG+VWAQS+ FP +KPEE+  +M DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGAVIR KKG GGVTVKKT QAL+IGIYDEPMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 58. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 226.9 bits 732,  Expect = 1e-61
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCEI-EGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGF 59
            MSWQAYVDDHLMC++ +G+   SAAIIGHDG+VWAQSA FP +KPEE+  IM DF+E GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVI 119
            LAPTGLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+V+
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  EKLGDYLIEQGM 131
            E+LGDYL+EQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 59. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 225.1 bits 726,  Expect = 5e-61
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQAYVD+HLMC+IEG  +HLTSAAI+G DGTVWAQSA FP FKPEEM  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTG+F+   KYMV+QGEPGAVIRGKKG+GG+ +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL+EQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 60. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 224.8 bits 725,  Expect = 6e-61
 Identities = 105/130 80%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEI-EGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGF 59
            MSWQAYVDDHLMC++ +G+ L SAAIIGHDG+VWAQSA FP +KPEE+  IM DF+E GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVI 119
            LAPTGLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+V+
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  EKLGDYLIEQGM 131
            E+LGDYL+EQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 61. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 224.8 bits 725,  Expect = 6e-61
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGHH---LTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
            MSWQAYVDDHLMC+IEGH    LT+AAI+GHDG+VWAQSA FP FKPEE+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QALV GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VIEKLGDYLIEQGM 131
            V+ +LGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 62. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 224.5 bits 724,  Expect = 8e-61
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVDDHLMC+IEG  +HLT AAI+G DG+VWAQSA FP FKP+E+A I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE G VIRGKKG GG+ VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 63. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 223.9 bits 722,  Expect = 1e-60
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            M WQ YVDDHLMCEIEG  +HL+ AAI+G DG+VWAQSA+FP FKP+E+A ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPG  IRGKKG GG+ VKKTGQALV GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 64. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 223.3 bits 720,  Expect = 2e-60
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMC++EG+ LT+AAI+G+DG+VWAQSA FP +KPEE+  I  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLF+G TKYMVIQGEP AVIRGKKG+GGVT+KKT QA+V GIY+EPMTPGQCNMV+E
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 65. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 223.3 bits 720,  Expect = 2e-60
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGH--HLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVD+HLMC+I+G+  HL +AAIIGHDG+VWAQS+ FP FK EE+++IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE GAVIRGKKGSGGVT+KKT QALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 66. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 222.4 bits 717,  Expect = 3e-60
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HL+CEIEG HL+SAAI+G+DG VWAQS+ FP FKPEE+  IM DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GGVT++KT QAL+IGIYD+PMTPGQCNM++E
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  KLGDYLIEQGM 131
            +LGDYLI+ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 67. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 222.0 bits 716,  Expect = 4e-60
 Identities = 98/131 74%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGH--HLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVD+HLMC+I+G+  HLT+AAIIGHDG++WAQS++FP +K +E+ +I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL L  TKYMVIQGEPGAVIRGKKGSGGVT+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 68. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 221.1 bits 713,  Expect = 8e-60
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVDDHLMCEIEG  +HLT+AAI+G DG+VWAQSA FP FKP+E++ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE G VIRGKKG GG+ VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 69. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 220.5 bits 711,  Expect = 1e-59
 Identities = 99/128 77%, Positives = 115/128 89%, Gaps = 0/128 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ+YVDDHLMC++EG+HLT+AAI+G+DG+VWAQSA FP +KP+E+  I KDF+EPGFL
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTGLFLG  KYMVIQGE GAVIRGKKG GGVT+KKT QALV G YDEPMT GQCN+V+E
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  KLGDYLIE 128
            +LGDYLIE
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 70. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 219.3 bits 707,  Expect = 3e-59
 Identities = 94/130 72%, Positives = 114/130 87%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVD+HLMC+++GH LTSAAI+GHDG+VWAQSA FP +KP E+  I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGGVT+KK+  AL+ G+YDEPMTPGQCN+V+E
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  KLGDYLIEQG 130
            +LGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 71. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 219.3 bits 707,  Expect = 3e-59
 Identities = 98/131 74%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGHHLTS--AAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVD+HLMC+I+G+   S  +AI+GHDG+VWAQS++FP FKP+E+  IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGL LG  KYMVIQGE GAVIRGKKGSGG+T+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYLI+QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 72. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 217.8 bits 702,  Expect = 8e-59
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVDDHLMC+IEG  +HLTSAAI G DGTVWA+SA+FP FKP E+  I+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMVIQGE GAVIRGKKG+GG+ +KKTGQA+V GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL++QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 213.9 bits 689,  Expect = 1e-57
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQ YVDDHLMC+IEG  +HLT+AAI+G DGTVWA+S  FP FKPEEM  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMV+QGE GAVIRGKKG+GG+ +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 213.3 bits 687,  Expect = 2e-57
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIE--GHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
            MSWQAYVD+HLMC IE  G+HLTS+AI+G DG++WAQS+ FP  KP+E+  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMVIQGEPGAVIRGKKG GGV +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  IEKLGDYLIEQGM 131
            +E+LGDYLIEQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 192.8 bits 619,  Expect = 2e-51
 Identities = 89/109 81%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
            MSWQ YVDDHLMCEIEG++LTSAAIIG+DG++WAQSA+FP FKPEE+  IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEP 109
            APTGL+LG TKYMVIQGE GAVIRGKKG GGVTVKKT QAL+IGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 169.5 bits 543,  Expect = 3e-44
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 28/130 21%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPA------------------- 41
            MSWQ YVDDHLMC++EGHHL SAAI+G DG+VWAQS AFP                    
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGV 92
                     FKPEE+ NIMKDFDEPGFLAPTGLFLG TKYMVIQGEPGAVIRGKKGS G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQG 130
            T+KKTGQAL+ GIY+EP+TPGQCNMV+EK+GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 77.0 bits 237,  Expect = 2e-16
 Identities = 47/122 38%, Positives = 70/122 57%, Gaps = 8/122 6%
Query  1    MSWQAYVDDHLMCEIEGHHLTSAAIIG-HDGTVWAQ-SAAFPA-FKPEEMANIMKDF-DE 56
            MSWQ+YVD+++ C+     L  A I G +DG VWA+    +P     +E+  I       
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCN 116
            P  +   G+ LG  KY+ IQ +  +++RG+KGS  + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVIEKLGDYL 126
             V+EKLGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.