The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL
APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE
RLGDYLIEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9XF41 Mal d 4 131 891 234.4 7.5e-64
CAD37202 Pru p 4.0201 131 871 229.3 2.6e-62
Q9AXH4 Cor a 2 131 825 217.6 8.9e-59
Q5XWE1 Citr l 2.0101 131 818 215.8 3.1e-58
AAK01235 Cor a 2 131 809 213.5 1.5e-57
Q9STB6 Hev b 8.0102 131 805 212.5 3.1e-57
O65809 Gly m 3 131 791 208.9 3.7e-56
AAL92870 Che a 2 131 791 208.9 3.7e-56
O22655 Zea m 12.0104 131 790 208.6 4.4e-56
AAL07320 Lit c 1 131 789 208.4 5.2e-56
AAP13533 Cuc m 2 131 788 208.1 6.2e-56
O65810 Gly m 3 131 788 208.1 6.2e-56
CAD10376 Cap a 2 131 787 207.9 7.4e-56
Q9FR39 Zea m 12.0105 131 784 207.1 1.3e-55
AAK54835 Ana c 1 131 778 205.6 3.7e-55
Q8L5D8 Pho d 2.0101 131 778 205.6 3.7e-55
AAL29690 Lyc e 1 131 776 205.1 5.2e-55
Q93YG7 Sola l 1.0101 131 769 203.3 1.8e-54
Q9M7N0 Hev b 8.0201 131 769 203.3 1.8e-54
CAD10377 Lyc e 1 131 769 203.3 1.8e-54
Q9FUD1 Ory s 12.0101 131 763 201.7 5.2e-54
Q9XF38 Pyr c 4 131 761 201.2 7.4e-54
O24650 Phl p 12.0102 131 760 201.0 8.8e-54
A0A2I4DNN6 Jug r 7.0101 131 759 200.7 1.1e-53
O04725 Cyn d 12 131 758 200.5 1.3e-53
FM164277 Tri a 12.0104 131 758 200.5 1.3e-53
ABU95412 Sin a 4.0101 131 758 200.5 1.3e-53
P35079 Phl p 12.0101 131 757 200.2 1.5e-53
O65812 Hev b 8.0101 131 757 200.2 1.5e-53
CAA54686 Phl p 12.0101 131 757 200.2 1.5e-53
Q9SQI9 Ara h 5 131 755 199.7 2.1e-53
AF377948 Mus a 1.0101 131 754 199.4 2.6e-53
P49233 Tri a 12.0102 141 753 199.2 3.3e-53
Q9XF42 Mal d 4 131 751 198.7 4.4e-53
QID21357 Pop n 2.0101 131 751 198.7 4.4e-53
P35083 Zea m 12.0103 131 750 198.4 5.2e-53
Q9XF37 Api g 4 134 749 198.2 6.3e-53
P52184 Hor v 12.0101 131 748 197.9 7.4e-53
Q9LEI8 Hev b 8.0204 131 747 197.7 8.8e-53
Q5EF31 Cro s 1.0101 131 747 197.7 8.8e-53
Q9M7M9 Hev b 8.0202 131 746 197.4 1.1e-52
AAL76933 Dau c 4 134 746 197.4 1.1e-52
CAD37201 Pru p 4.0101 131 745 197.1 1.3e-52
Q9M7M8 Hev b 8.0203 131 745 197.1 1.3e-52
A0A023W2L7 Pro j 2.0101 133 745 197.1 1.3e-52
O24169 Ole e 2 134 745 197.1 1.3e-52
O24170 Ole e 2 134 744 196.9 1.5e-52
O24282 Phl p 12.0103 131 743 196.6 1.8e-52
P49232 Tri a 12.0101 138 743 196.6 1.9e-52
P49234 Tri a 12.0103 140 742 196.4 2.3e-52
Q9XF40 Mal d 4 131 741 196.1 2.6e-52
Q9XG85 Par j 3 132 741 196.1 2.6e-52
O49894 Mer a 1 133 740 195.9 3.1e-52
AY081852 Pru du 4.0102 131 739 195.6 3.6e-52
AY081850 Pru du 4.0101 131 739 195.6 3.6e-52
P35081 Zea m 12.0101 131 739 195.6 3.6e-52
O24171 Ole e 2 134 739 195.6 3.7e-52
Q9XF39 Pru av 4 131 738 195.4 4.3e-52
ACP43298 Ama r 2.0101 133 734 194.3 9e-52
P35082 Zea m 12.0102 131 733 194.1 1.1e-51
QRN65366 Lig v 2.0101 134 731 193.6 1.5e-51
Q9T0M8 Par j 3 131 728 192.8 2.5e-51
Q42449 Ara t 8 131 724 191.8 5.2e-51
P84177 Cit s 2.0101 131 722 191.3 7.4e-51
A0A0A0RCW1 Aca f 2 133 720 190.8 1.1e-50
A0A0A0REA1 Koc s 2.0101 133 717 190.0 1.8e-50
ACS34771 Sal k 4.0101 133 716 189.7 2.2e-50
QVU02258 Que ac 2.0101 133 712 188.7 4.4e-50
XP030492464 Can s 2.0101 133 709 188.0 7.5e-50
ADK22841 Sal k 4.0201 133 703 186.4 2.2e-49
P25816 Bet v 2 133 699 185.4 4.4e-49
O81982 Hel a 2 133 682 181.1 8.9e-48
AJ421031 Art v 4.0201 133 670 178.0 7.4e-47
AJ421030 Art v 4.0101 133 665 176.7 1.8e-46
FG438715 Act d 9.0101 109 645 171.6 5.1e-45
QEQ43417 Sola m 1.0101 159 486 131.0 1.2e-32
A0A1B2YLJ4 Tyr p 36.0101 131 256 72.3 4.9e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 234.4 bits 891,  Expect = 8e-64
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 2. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 229.3 bits 871,  Expect = 3e-62
 Identities = 125/131 95%, Positives = 130/131 99%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMCEIEGNHLSAAAIIGH+GSVWAQSATFPQLKPEEVTGI+NDFNEPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKGPGGVTVKKST+ALLIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 3. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 217.6 bits 825,  Expect = 9e-59
 Identities = 116/131 88%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAY D+HLMCEIEGN L+AAAIIGH+GSVWAQS+TFPQLKPEE+TG+MNDFNEPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKGPGGVTVKK++ AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 4. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 215.8 bits 818,  Expect = 3e-58
 Identities = 113/131 86%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMCEIEGNHL++AAIIG++GSVWA+S  FPQLKPEE+TGI+NDFNEPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLY+GG+KYMVIQGEPG VIRGKKGPGGVTVKK+ +AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 5. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 213.5 bits 809,  Expect = 2e-57
 Identities = 114/131 87%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ Y D+HLMCEIEGN L+AAAIIGH+GSVWAQS+TFPQLKPEE+TG+MNDFNEPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIR KKGPGGVTVKK++ AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 212.5 bits 805,  Expect = 3e-57
 Identities = 113/130 86%, Positives = 125/130 96%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMCEIEGNHLSAAAIIG++GSVWAQSA FPQ+K EE+TGIM+DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPG VIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 7. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 208.9 bits 791,  Expect = 4e-56
 Identities = 112/130 86%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEGNHL+ AAIIG++GSVWAQS  FPQ+KPEE+T IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            R GDYLI+QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 8. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 208.9 bits 791,  Expect = 4e-56
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+IEGNHLS+AAI+GH+G+VWAQS +FPQLKPEEV+ IM DFNEPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGGVT+KK+  AL+IGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            R+GDYL+EQG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 9. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 208.6 bits 790,  Expect = 4e-56
 Identities = 108/131 82%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVD+HLMCEIEG HLSAAAI+GH+GSVWAQS +FP+LKPEEV GI+ DF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGVVIRGKKG GG+T+KK+ M+L+IG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 10. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 208.4 bits 789,  Expect = 5e-56
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMCE +G HL+AAAIIGH+GSVWAQSA FPQ+KP E+  IM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKGPGG+TVKK+T AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 11. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 208.1 bits 788,  Expect = 6e-56
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEGNHL++AAIIG++GSVWAQS  FPQLKPEEV GI+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLY+GGTKYMVIQGEPG VIRGKKGPGGVTVKK+ MAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 12. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 208.1 bits 788,  Expect = 6e-56
 Identities = 112/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHL+C IEGNHL+ AAIIG++GSVW QS  FPQ+KPEE+T IMNDFNEPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKGPGGVTVKK+  AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 13. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 207.9 bits 787,  Expect = 7e-56
 Identities = 111/131 84%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMCEIEGN L++AAIIG++GSVWAQSATFPQ+KPEE+T IMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGE G VIRGKKGPGG+TVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 14. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 207.1 bits 784,  Expect = 1e-55
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHL+C+IEG HLSAAAI+GH+GSVWAQS  FP+LKPEEV G++ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGVVIRGKKG GG+T+KK+ M+L+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 15. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 205.6 bits 778,  Expect = 4e-55
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMCEI+G HLS+AAI+GH+ +VWAQS  FPQ+KPEE++ I+NDF  PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPGVVIRGKKG GG+TVKK+ +AL+IG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 16. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 205.6 bits 778,  Expect = 4e-55
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVD+HLMCEI+G+HL+AAAI+GH+GSVWAQS++FPQ+K EE+T IMNDFNEPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLG TKYMVIQGEPG VIRGKKG GGVTVKK+  AL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 17. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 205.1 bits 776,  Expect = 5e-55
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+IEGNHL++AAIIG++GSVWAQSA FPQ+KPEE+T IMNDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDY+IEQGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 18. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 203.3 bits 769,  Expect = 2e-54
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HL+CE EGNHL++AAIIG++G+VWAQSA FPQ+KPEE+TGIMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP  VIRGKKGPGG+T+KK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 19. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 203.3 bits 769,  Expect = 2e-54
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMC+I+G+HL+AAAIIGH+GSVWAQS++FPQ+KPEEV  IM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 20. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 203.3 bits 769,  Expect = 2e-54
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HL+CE EGNHL++AAIIG++G+VWAQSA FPQ+KPEE+TGIMNDF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEP  VIRGKKGPGG+T+KK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 21. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 201.7 bits 763,  Expect = 5e-54
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+VWAQSA FPQ+KPEE+T IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GG+TVKK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 22. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 201.2 bits 761,  Expect = 7e-54
 Identities = 105/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMC+I+G+HL+AAAI+GH+GSVWAQS+TFP++KPEE+T IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGVTVKK++ AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 23. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 201.0 bits 760,  Expect = 9e-54
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+VWAQSA FPQ+KPEE+TGIM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 24. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 200.7 bits 759,  Expect = 1e-53
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEI+G HL+AAAIIGH+GSVWAQS++FPQ+KPEE+  IM DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TVKK+  AL+ GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 25. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 200.5 bits 758,  Expect = 1e-53
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMCEIEG+HL++AAIIGH+G+VWAQSA FP +KPEE+  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GGVTVKK+  AL+IGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQGL 131
            +LGDYLIEQG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 26. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 200.5 bits 758,  Expect = 1e-53
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSW+AYVDDHL CEI+G HL++AAI+GH+GSVWAQS  FPQ+KPEE+ GI+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ MAL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 27. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 200.5 bits 758,  Expect = 1e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC++EGN L+AAAI+G++GSVWAQSA FPQLKPEE+ GI NDF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP  VIRGKKG GGVT+KK+T A++ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 28. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 200.2 bits 757,  Expect = 2e-53
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+VWAQSA FPQ+KPEE+TGIM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 29. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 200.2 bits 757,  Expect = 2e-53
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+ LMCEIEGNHL+AAAIIG++GSVWAQS+ FPQ+K EE+T IM+DF+EPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKGPGGVTV+K+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 30. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 200.2 bits 757,  Expect = 2e-53
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+VWAQSA FPQ+KPEE+TGIM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 31. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 199.7 bits 755,  Expect = 2e-53
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HL+CEIEG+HLS+AAI+G++G VWAQS+ FPQ+KPEE+T IMNDF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG +I GKKGPGGVT++K+  AL+IGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+ GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 32. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 199.4 bits 754,  Expect = 3e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHL+C+I+G  L+AAAI+GH+GSVWAQS  FPQ KPEE+  IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGLYLGGTKYMVIQGEPG VIRGKKG GGVT+KK+ +AL+IGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL +QG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 33. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 199.2 bits 753,  Expect = 3e-53
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHL CEI+G HL++AAI+GH+GSVWA+S  FP++KPEE+ GI+ DF EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ MAL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 34. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 198.7 bits 751,  Expect = 4e-53
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G++GSVW+QSA+FP +KPEE+  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KK++ ALLIGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 198.7 bits 751,  Expect = 4e-53
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+IEGN L++AAIIGH+GSVWA SA+FPQ+  EEV+ IM DF EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GGVTVKK+  AL+IG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 198.4 bits 750,  Expect = 5e-53
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HLS+AAI+GH+G+VWAQS  FPQ+KPEE+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPG VIRGKKG GG+TVKK+  AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 37. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 198.2 bits 749,  Expect = 6e-53
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGNH---LSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQAYVDDHLMCE+EGN    L+AAAIIGH+GSVWAQS+TFPQ+KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G LAPTGLYLGG KYMVIQGEP  VIRGKKG GGVT+KK+  AL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIEQGL 131
            +VERLGDYLI+QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 38. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 197.9 bits 748,  Expect = 7e-53
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHL CEI+G HL++AAI+GH+G VW QS  FPQ+KPEE+ GI+ DF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ M L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 39. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 197.7 bits 747,  Expect = 9e-53
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+I+G+ L+AAAIIGH+GSVWAQS++FPQ+K +EV  +M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 40. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 197.7 bits 747,  Expect = 9e-53
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMC+++G+ L++AAI+GH+GSVWAQSA FP+LKP E+T I+NDFNEPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTG+Y+ G KYMVIQGEPGVVIRGKKG GGVT+KKS MAL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 41. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 197.4 bits 746,  Expect = 1e-52
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+I+G+ L+AAAIIGH+GSVWAQS++FPQ+K +EV  IM DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GG+TVKK++ AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 42. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 197.4 bits 746,  Expect = 1e-52
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGN---HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQ YVDDHLMCE++GN   +LSAAAIIGH+GSVWAQS+TFP++KPEE+TGIM +F+EP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G LAPTGLYLGGTKYMVIQGEP  VIRGKKG GGVT+KK+  AL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIEQGL 131
            +VERLGDYLIEQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 43. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 197.1 bits 745,  Expect = 1e-52
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G++GSVW+QSATFP +KPEE+  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 44. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 197.1 bits 745,  Expect = 1e-52
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+I+G+ L+AAAIIGH+GSVWAQS+ FPQ+K +EV  +M DF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 45. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 197.1 bits 745,  Expect = 1e-52
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVDDHLMCEIEG  NHLSAAAI+G +GSVWAQSA+FPQ+KP+E++ ++ DF+ PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKGPGG+ VKK+  AL+IGIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 46. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 197.1 bits 745,  Expect = 1e-52
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEG--NH-LSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQAYVDDHLMC+IEG  +H L+AAAI+GH+GSVWAQSATFPQ+KPEE+ GIM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 47. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 196.9 bits 744,  Expect = 2e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGNH---LSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQAYVDDHLMC+IEG+    L+AAAI+GH+GSVWAQSATFPQ+KPEE+ GIM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            VVERLGDYL+EQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 48. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 196.6 bits 743,  Expect = 2e-52
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HL++AAI GH+G+VWAQSA FPQ+KPEE+TGIM D++EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPG VIRGKKG GG+T+KK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 49. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 196.6 bits 743,  Expect = 2e-52
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHL CEI+G HL++AAI+GH+GSVW +S  FP++KPEE+ GI+ DF EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ MAL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 50. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 196.4 bits 742,  Expect = 2e-52
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSW+AYVDDHL CEI+G +L++AAI+GH+GSVWAQS  FPQ+KPEE  GI+ DF EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ MAL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLI+QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 51. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 196.1 bits 741,  Expect = 3e-52
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDD LMC+I+G+HL+AAAI+GH+GSVWA+S+TFP++KPEE+T IM DF+EPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGVTVKK+  AL+ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLI+QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 52. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 196.1 bits 741,  Expect = 3e-52
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGS 59
            MSWQAYVDDHLMC++ +GN  ++AAIIGH+GSVWAQSA FPQLKPEEVTGIMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE G VIRGKKG GG T+KK+  A++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQGL 131
            ERLGDYL+EQGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 53. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 195.9 bits 740,  Expect = 3e-52
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVDDHLMC+I+G   HL+AA+I+GH+GS+WAQSA+FPQLKPEE+TGIM DF+EPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
             LAPTGLY+ GTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 54. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 195.6 bits 739,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+I+GN L+AAAI+G++GSVW+QSATFP +KPEE+  I+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 55. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 195.6 bits 739,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMC+I+GN L+AAAI+G++GSVW+QSATFP +KPEE+  I+ DF++PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 56. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 195.6 bits 739,  Expect = 4e-52
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+ WAQS  FP++KPEE+  IM DF+EPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TVKK+  +L+IGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 57. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 195.6 bits 739,  Expect = 4e-52
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEGNH---LSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQAYVDDHLMC+IEG+    L+AAAI+GH+GSVWAQSATFPQ+KPEE+ GIM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            V ERLGDYL+EQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 58. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 195.4 bits 738,  Expect = 4e-52
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G++GSVW+QSATFP +KPEE+  I+ D+++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+TVKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 59. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 194.3 bits 734,  Expect = 9e-52
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQAYVDDHLMCEIEG  NHL+ AAI+G +GSVWAQSA FPQ+KP+E+  I+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKG GG+ VKK+  AL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 60. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 194.1 bits 733,  Expect = 1e-51
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVD+HLMCEIEG+HL+AAAI+GH+G+ WAQS  FP++K E++  IM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GG+TVKK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 61. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 193.6 bits 731,  Expect = 2e-51
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEIEG--NH-LSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQAYVDDHLMC+IEG  +H L+AAAI+GH+GSVWAQSATFPQ+KPEE+ GIM DFNEP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G+LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGL 131
            VV RLGD L++QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 62. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 192.8 bits 728,  Expect = 3e-51
 Identities = 106/130 81%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEI-EGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGS 59
            MSWQAYVDDHLMC++ +GN L++AAIIGH+GSVWAQSA FPQLKPEEVTGIMNDFNE G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVV 119
            LAPTGL+LGGTKYMVIQGE G VI GKKG GG T+KK+  A++IGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQGL 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 63. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 191.8 bits 724,  Expect = 5e-51
 Identities = 101/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ+YVDDHLMC++EGNHL+AAAI+G++GSVWAQSA FPQLKP+E+ GI  DF EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGG KYMVIQGE G VIRGKKGPGGVT+KK+  AL+ G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIE  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 64. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 191.3 bits 722,  Expect = 7e-51
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQAYVDDHLMC+I+GN L+AAAI+G++GSVW+QSATFP ++ EE+  I+ DF++PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+ VKK+  AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGL 131
            RLGDYLIEQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 65. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 190.8 bits 720,  Expect = 1e-50
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            M WQ YVDDHLMCEIEG  NHLS AAI+G +GSVWAQSA+FPQ+KP+E+  ++ DF+ PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGEPG  IRGKKGPGG+ VKK+  AL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 66. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 190.0 bits 717,  Expect = 2e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVDDHLMC+IEG  NHL+ AAI+G +GSVWAQSA FPQ+KP+E+  I+ +F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKK+  AL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 67. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 189.7 bits 716,  Expect = 2e-50
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVDDHLMCEIEG  NHL+AAAI+G +GSVWAQSA FPQ+KP+E++ ++ +F+E G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKK+  AL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 68. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 188.7 bits 712,  Expect = 4e-50
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVD+HLMC+I+G   HL+AAAIIGH+GSVWAQS+ FPQ+K EE++ IM DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
             LAPTGL+LGGTKYMVIQGE G VIRGKKG GGVT+KK++ AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 69. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 188.0 bits 709,  Expect = 7e-50
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVD+HLMC+I+G   HL+AAAIIGH+GS+WAQS++FPQLK +E+T I  DF EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
             LAPTGL+L GTKYMVIQGEPG VIRGKKG GGVT+KK+  AL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 70. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 186.4 bits 703,  Expect = 2e-49
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIE--GNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQAYVD+HLMC IE  GNHL+++AI+G +GS+WAQS+ FPQ+KP+E+  I  +F+ P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMVIQGEPG VIRGKKGPGGV +KK+T AL+ GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYLIEQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 71. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 185.4 bits 699,  Expect = 4e-49
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 4/130 3%
Query  1    MSWQAYVDDHLMCEIEG---NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
            MSWQ YVD+HLMC+I+G   N L A+AI+GH+GSVWAQS++FPQ+KP+E+TGIM DF EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSL-ASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
            G LAPTGL+LGG KYMVIQGE G VIRGKKG GG+T+KK+  AL+ GIY+EP+TPGQCNM
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  118  VVERLGDYLIEQGL 131
            VVERLGDYLI+QGL
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 72. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 181.1 bits 682,  Expect = 9e-48
 Identities = 91/131 69%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQAYVD+HLMC+IEG   HL++AAI+G +G+VWAQSA FPQ+KPEE+ GI+ +F+E G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTG+++ G KYMV+QGEPG VIRGKKG GG+ +KK+  A+++GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 178.0 bits 670,  Expect = 7e-47
 Identities = 90/131 68%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVDDHLMC+IEG   HL+AAAI+G +G+VWA+S  FP++KPEE+ GI+N+FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
            +LAPTGL+LGG KYMV+QGE G VIRGKKG GG+ +KK+  A+++GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 176.7 bits 665,  Expect = 2e-46
 Identities = 90/131 68%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
            MSWQ YVDDHLMC+IEG   HL++AAI G +G+VWA+SA+FP++KP E+  I+ +FNE G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
             LAPTGL+LGG KYMVIQGE G VIRGKKG GG+ +KK+  A++ GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 171.6 bits 645,  Expect = 5e-45
 Identities = 90/109 82%, Positives = 103/109 94%, Gaps = 0/109 0%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
            MSWQ YVDDHLMCEIEGN+L++AAIIG++GS+WAQSA+FPQ+KPEE+T IMNDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEP 109
            APTGLYLGGTKYMVIQGE G VIRGKKGPGGVTVKK+  AL+IGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 131.0 bits 486,  Expect = 1e-32
 Identities = 95/130 73%, Positives = 117/130 90%, Gaps = 28/130 21%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQ------------------- 41
            MSWQ YVDDHLMC++EG+HL++AAI+G +GSVWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------LKPEEVTGIMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGV 92
                     +KPEE+T IM DF+EPG LAPTGL+LGGTKYMVIQGEPG VIRGKKG  G+
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLIEQG 130
            T+KK+  AL+ GIY+EP+TPGQCNMVVE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 72.3 bits 256,  Expect = 5e-15
 Identities = 49/122 40%, Positives = 76/122 62%, Gaps = 8/122 6%
Query  1    MSWQAYVDDHLMCEIEGNHLSAAAIIG-HNGSVWAQ-SATFP-QLKPEEVTGIMNDF-NE 56
            MSWQ+YVD+++ C+     L  A I G ++G+VWA+    +P Q+  +E+  I +   + 
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCN 116
            P S+   G++LGG KY+ IQ +  +V RG+KG   + +  +   LL     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQADNSLV-RGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.