The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG
TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI
VERLGDYLIEQGY
Sequence Info Allergen Name Length Opt Bits Score E Value
ACP43298 Ama r 2.0101 133 914 233.9 1.1e-63
A0A0A0REA1 Koc s 2.0101 133 844 216.5 1.9e-58
A0A023W2L7 Pro j 2.0101 133 835 214.3 9.1e-58
A0A0A0RCW1 Aca f 2 133 833 213.8 1.3e-57
ACS34771 Sal k 4.0101 133 819 210.3 1.4e-56
Q9M7N0 Hev b 8.0201 131 776 199.6 2.3e-53
O81982 Hel a 2 133 774 199.1 3.3e-53
A0A2I4DNN6 Jug r 7.0101 131 773 198.9 3.9e-53
AAL29690 Lyc e 1 131 772 198.6 4.6e-53
AAL07320 Lit c 1 131 767 197.4 1.1e-52
O65809 Gly m 3 131 766 197.1 1.3e-52
Q9M7M8 Hev b 8.0203 131 765 196.9 1.5e-52
O65810 Gly m 3 131 763 196.4 2.2e-52
Q9LEI8 Hev b 8.0204 131 762 196.1 2.6e-52
Q9STB6 Hev b 8.0102 131 762 196.1 2.6e-52
Q9XF42 Mal d 4 131 757 194.9 6.1e-52
O24169 Ole e 2 134 754 194.1 1.1e-51
O24650 Phl p 12.0102 131 752 193.7 1.4e-51
Q9XF38 Pyr c 4 131 751 193.4 1.7e-51
CAD37201 Pru p 4.0101 131 751 193.4 1.7e-51
Q9M7M9 Hev b 8.0202 131 751 193.4 1.7e-51
O04725 Cyn d 12 131 750 193.2 2e-51
O24170 Ole e 2 134 750 193.1 2.1e-51
Q5XWE1 Citr l 2.0101 131 747 192.4 3.4e-51
FM164277 Tri a 12.0104 131 747 192.4 3.4e-51
AAP13533 Cuc m 2 131 747 192.4 3.4e-51
AJ421030 Art v 4.0101 133 746 192.1 4.1e-51
Q9FUD1 Ory s 12.0101 131 745 191.9 4.8e-51
CAA54686 Phl p 12.0101 131 745 191.9 4.8e-51
AY081852 Pru du 4.0102 131 745 191.9 4.8e-51
AY081850 Pru du 4.0101 131 745 191.9 4.8e-51
P35079 Phl p 12.0101 131 745 191.9 4.8e-51
O24171 Ole e 2 134 745 191.9 5e-51
Q9XF39 Pru av 4 131 744 191.7 5.7e-51
O65812 Hev b 8.0101 131 744 191.7 5.7e-51
CAD10376 Cap a 2 131 744 191.7 5.7e-51
Q9XF40 Mal d 4 131 743 191.4 6.8e-51
O22655 Zea m 12.0104 131 743 191.4 6.8e-51
CAD37202 Pru p 4.0201 131 743 191.4 6.8e-51
AJ421031 Art v 4.0201 133 743 191.4 7e-51
P49233 Tri a 12.0102 141 742 191.1 9.1e-51
Q9FR39 Zea m 12.0105 131 741 190.9 9.6e-51
AAL92870 Che a 2 131 740 190.7 1.1e-50
Q9XF37 Api g 4 134 740 190.6 1.2e-50
ADK22841 Sal k 4.0201 133 739 190.4 1.4e-50
P35081 Zea m 12.0101 131 737 189.9 1.9e-50
P35083 Zea m 12.0103 131 734 189.2 3.2e-50
Q9XF41 Mal d 4 131 734 189.2 3.2e-50
P52184 Hor v 12.0101 131 734 189.2 3.2e-50
AAK54835 Ana c 1 131 734 189.2 3.2e-50
QRN65366 Lig v 2.0101 134 734 189.2 3.3e-50
O24282 Phl p 12.0103 131 733 188.9 3.8e-50
P84177 Cit s 2.0101 131 733 188.9 3.8e-50
O49894 Mer a 1 133 733 188.9 3.9e-50
P49232 Tri a 12.0101 138 732 188.6 4.9e-50
P49234 Tri a 12.0103 140 730 188.1 7.1e-50
Q8L5D8 Pho d 2.0101 131 729 187.9 7.6e-50
AAL76933 Dau c 4 134 727 187.4 1.1e-49
Q9AXH4 Cor a 2 131 726 187.2 1.3e-49
XP030492464 Can s 2.0101 133 726 187.2 1.3e-49
QID21357 Pop n 2.0101 131 725 186.9 1.5e-49
QVU02258 Que ac 2.0101 133 725 186.9 1.5e-49
ABU95412 Sin a 4.0101 131 723 186.4 2.1e-49
CAD10377 Lyc e 1 131 721 185.9 3e-49
Q93YG7 Sola l 1.0101 131 721 185.9 3e-49
AF377948 Mus a 1.0101 131 719 185.4 4.2e-49
P35082 Zea m 12.0102 131 717 185.0 6e-49
P25816 Bet v 2 133 717 184.9 6.1e-49
Q9SQI9 Ara h 5 131 711 183.5 1.7e-48
AAK01235 Cor a 2 131 710 183.2 2e-48
Q9XG85 Par j 3 132 691 178.5 5.4e-47
Q42449 Ara t 8 131 690 178.2 6.3e-47
Q5EF31 Cro s 1.0101 131 689 178.0 7.5e-47
Q9T0M8 Par j 3 131 680 175.8 3.5e-46
FG438715 Act d 9.0101 109 614 159.5 2.2e-41
QEQ43417 Sola m 1.0101 159 516 134.8 9.2e-34
A0A1B2YLJ4 Tyr p 36.0101 131 290 78.8 5.4e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 233.9 bits 914,  Expect = 1e-63
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQGY 133
            VERLGDYLIEQGY
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 2. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 216.5 bits 844,  Expect = 2e-58
 Identities = 120/132 90%, Positives = 127/132 96%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+IEGTTNHLTGAAILG+DGSVWAQSA+FPQFKPDEIAAIV++FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE G VIRGKKG GGICVKKTGQAL+ GIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 3. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 214.3 bits 835,  Expect = 9e-58
 Identities = 117/132 88%, Positives = 125/132 94%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMCEIEGT NHL+ AAILG+DGSVWAQSA FPQFKPDEI+A+V+DFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEPG VIRGKKG GGICVKKTGQAL++GIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 4. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 213.8 bits 833,  Expect = 1e-57
 Identities = 118/132 89%, Positives = 123/132 93%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            M WQ YVDDHLMCEIEGT NHL+GAAILG+DGSVWAQSA FPQFKPDEIAA+V+DFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEPG  IRGKKG GGICVKKTGQALV GIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 5. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 210.3 bits 819,  Expect = 1e-56
 Identities = 116/132 87%, Positives = 124/132 93%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMCEIEGT NHLT AAILG+DGSVWAQSA+FPQFKPDEI+A+V++FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE G VIRGKKG GGICVKKTGQAL+ GIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 6. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 199.6 bits 776,  Expect = 2e-53
 Identities = 109/130 83%, Positives = 125/130 96%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMC+I+G  +HLT AAI+G DGSVWAQS+ FPQFKP+E+AAI++DFDEPG
Sbjct  1    MSWQTYVDEHLMCDIDG--HHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGEPGAVIRGKKG+GGI VKKTGQAL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 7. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 199.1 bits 774,  Expect = 3e-53
 Identities = 105/132 79%, Positives = 121/132 91%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVD+HLMC+IEGT  HLT AAILGLDG+VWAQSA FPQFKP+E+  I+++FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTG+ + G KYMV+QGEPGAVIRGKKGAGGIC+KKTGQA++MGIYDEPV PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 8. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 198.9 bits 773,  Expect = 4e-53
 Identities = 111/130 85%, Positives = 122/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEI+G   HLT AAI+G DGSVWAQS+ FPQFKP+EIAAI++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIDG--QHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE GAVIRGKKGAGGI VKKTGQAL+ GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 9. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 198.6 bits 772,  Expect = 5e-53
 Identities = 112/130 86%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+IEG  NHLT AAI+G DGSVWAQSA+FPQFKP+EI AI+ DF EPG
Sbjct  1    MSWQTYVDDHLMCDIEG--NHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE GAVIRGKKGAGGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDY+IEQG
Sbjct  119  VERLGDYIIEQG 130

Sequence Alignment: 10. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 197.4 bits 767,  Expect = 1e-52
 Identities = 109/130 83%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMCE +G   HLT AAI+G DGSVWAQSA+FPQFKP EIAAI++DFDEPG
Sbjct  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGEPGAVIRGKKG GGI VKKT QAL++GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLVDQG 130

Sequence Alignment: 11. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 197.1 bits 766,  Expect = 1e-52
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHL+C+IEG  NHLT AAI+G DGSVWAQS DFPQFKP+EI AI+ DF+EPG
Sbjct  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG GG+ VKKTG AL++GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGY 133
            VER GDYLI+QGY
Sbjct  119  VERPGDYLIDQGY 131

Sequence Alignment: 12. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 196.9 bits 765,  Expect = 2e-52
 Identities = 108/130 83%, Positives = 123/130 94%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+I+G  + LT AAI+G DGSVWAQS+ FPQFK DE+AA+++DFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGEPGAVIRGKKG+GGI VKKTGQAL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 13. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 196.4 bits 763,  Expect = 2e-52
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHL+C IEG  NHLT AAI+G DGSVW QS DFPQFKP+EI AI+ DF+EPG
Sbjct  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG GG+ VKKTG AL++GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLI+QGY
Sbjct  119  VERLGDYLIDQGY 131

Sequence Alignment: 14. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 196.1 bits 762,  Expect = 3e-52
 Identities = 107/130 82%, Positives = 123/130 94%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+I+G  + LT AAI+G DGSVWAQS+ FPQFK DE+AA+++DFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGEPGAVIRGKKG+GGI VKKTGQAL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLLDQG 130

Sequence Alignment: 15. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 196.1 bits 762,  Expect = 3e-52
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEIEG  NHL+ AAI+G DGSVWAQSA+FPQFK +EI  I+ DF EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL++GGTKYMVIQGEPGAVIRGKKG GG+ VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLI+QGY
Sbjct  119  VERLGDYLIDQGY 131

Sequence Alignment: 16. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 194.9 bits 757,  Expect = 6e-52
 Identities = 109/130 83%, Positives = 122/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI++DFD+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGEPGAVIRGKKG+GGI +KKT QAL++GIYDEPVTPGQCN++
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 17. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 194.1 bits 754,  Expect = 1e-51
 Identities = 108/132 81%, Positives = 120/132 90%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
            MSWQAYVDDHLMC+IEG  +H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLIEQG 132
            +VERLGDYL+EQG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 18. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 193.7 bits 752,  Expect = 1e-51
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HL  AAILG DG+VWAQSADFPQFKP+EI  I++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTG+ + G KYMVIQGEPGAVIRGKKGAGGI +KKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 19. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 193.4 bits 751,  Expect = 2e-51
 Identities = 108/130 83%, Positives = 122/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC+I+G  +HLT AAILG DGSVWAQS+ FP+FKP+EI AI++DFDEPG
Sbjct  1    MSWQAYVDDHLMCDIDG--HHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GG+ VKKT QALV GIY+EP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 20. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 193.4 bits 751,  Expect = 2e-51
 Identities = 110/130 84%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI++DFD+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGE GAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 21. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 193.4 bits 751,  Expect = 2e-51
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+I+G  + LT AAI+G DGSVWAQS+ FPQFK DE+AAI++DFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLG TKYMVIQGEPGAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 22. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 193.2 bits 750,  Expect = 2e-51
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEIEG  +HLT AAI+G DG+VWAQSA FP FKP+E+A I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LG TKYMVIQGEPGAVIRGKKG+GG+ VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            +E+LGDYLIEQG
Sbjct  119  IEKLGDYLIEQG 130

Sequence Alignment: 23. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 193.1 bits 750,  Expect = 2e-51
 Identities = 108/132 81%, Positives = 119/132 90%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
            MSWQAYVDDHLMC+IEG   H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLIEQG 132
            +VERLGDYL+EQG
Sbjct  121  VVERLGDYLLEQG 133

Sequence Alignment: 24. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 192.4 bits 747,  Expect = 3e-51
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEIEG  NHLT AAI+G DGSVWA+S +FPQ+KP+EI  I+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL++GG+KYMVIQGEPGAVIRGKKG GG+ VKKT  ALV+GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 25. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 192.4 bits 747,  Expect = 3e-51
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSW+AYVDDHL CEI+G   HLT AAILG DGSVWAQS +FPQFKP+EIA IV+DF+EPG
Sbjct  1    MSWKAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG AL++GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLI+QGY
Sbjct  119  VERLGDYLIDQGY 131

Sequence Alignment: 26. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 192.4 bits 747,  Expect = 3e-51
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  NHLT AAI+G DGSVWAQS +FPQ+KP+E+A IV DF +PG
Sbjct  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL++GGTKYMVIQGEPGAVIRGKKG GG+ VKKTG ALV+GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 27. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 192.1 bits 746,  Expect = 4e-51
 Identities = 103/132 78%, Positives = 118/132 89%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+IEGT  HLT AAI+G DG+VWA+SA FP+FKP+EI AI+++F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGG KYMVIQGE GAVIRGKKGAGGIC+KKTGQA+V GIYDEPV PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL++QG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 28. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 191.9 bits 745,  Expect = 5e-51
 Identities = 107/130 82%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HLT AAI+G DG+VWAQSA FPQFKP+E+  I++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LG TKYMVIQGEPGAVIRGKKG+GGI VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 29. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 191.9 bits 745,  Expect = 5e-51
 Identities = 105/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HL  AAILG DG+VWAQSADFPQFKP+EI  I++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTG+ + G KYMVIQGEPG VIRGKKGAGGI +KKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 30. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 191.9 bits 745,  Expect = 5e-51
 Identities = 109/130 83%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI++DFD+PG
Sbjct  1    MSWQQYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGE GAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 31. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 191.9 bits 745,  Expect = 5e-51
 Identities = 109/130 83%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI++DFD+PG
Sbjct  1    MSWQQYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGE GAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 32. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 191.9 bits 745,  Expect = 5e-51
 Identities = 105/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HL  AAILG DG+VWAQSADFPQFKP+EI  I++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTG+ + G KYMVIQGEPG VIRGKKGAGGI +KKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 33. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 191.9 bits 745,  Expect = 5e-51
 Identities = 107/132 81%, Positives = 118/132 89%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
            MSWQAYVDDHLMC+IEG   H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
            G LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLIEQG 132
            + ERLGDYL+EQG
Sbjct  121  VAERLGDYLLEQG 133

Sequence Alignment: 34. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 191.7 bits 744,  Expect = 6e-51
 Identities = 109/130 83%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI++D+D+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGE GAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 35. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 191.7 bits 744,  Expect = 6e-51
 Identities = 107/130 82%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+ LMCEIEG  NHLT AAI+G DGSVWAQS++FPQFK +EI AI+ DFDEPG
Sbjct  1    MSWQTYVDERLMCEIEG--NHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE GAVIRGKKG GG+ V+KT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 36. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 191.7 bits 744,  Expect = 6e-51
 Identities = 110/129 85%, Positives = 117/129 90%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMCEIEG  N LT AAI+G DGSVWAQSA FPQFKP+EI AI+ DF EPG
Sbjct  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL+LGGTKYMVIQGE GAVIRGKKG GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQ 131
            VERLGDYLIEQ
Sbjct  119  VERLGDYLIEQ 129

Sequence Alignment: 37. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 191.4 bits 743,  Expect = 7e-51
 Identities = 107/130 82%, Positives = 122/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDD LMC+I+G  +HLT AAILG DGSVWA+S+ FP+FKP+EI AI++DFDEPG
Sbjct  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GG+ VKKTGQALV GIY+EP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 38. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 191.4 bits 743,  Expect = 7e-51
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVD+HLMCEIEG   HL+ AAI+G DGSVWAQS  FP++KP+E+A I++DFDEPG
Sbjct  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL +GGTKYMVIQGEPG VIRGKKG GGI +KKTG +L++G+YDEP+TPGQCNM+
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGF 131

Sequence Alignment: 39. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 191.4 bits 743,  Expect = 7e-51
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEIEG  NHL+ AAI+G DGSVWAQSA FPQ+KP+E+  I+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG GG+ VKK+  AL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 40. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 191.4 bits 743,  Expect = 7e-51
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+IEGT  HLT AAILGLDG+VWA+S  FP+FKP+E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGG KYMV+QGE GAVIRGKKGAGGIC+KKTGQA+VMGIYDEPV PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLIEQ 131
            VERLGDYL++Q
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 41. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 191.1 bits 742,  Expect = 9e-51
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHL CEI+G   HLT AAILG DGSVWA+S +FP+FKP+EIA IV+DF+EPG
Sbjct  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG AL++GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLI+QGY
Sbjct  119  VERLGDYLIDQGY 131

Sequence Alignment: 42. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 190.9 bits 741,  Expect = 1e-50
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHL+C+IEG   HL+ AAI+G DGSVWAQS +FP++KP+E+A +++DFDEPG
Sbjct  1    MSWQAYVDDHLLCDIEG--QHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL +GGTKYMVIQGEPG VIRGKKG GGI +KKTG +L++GIYDEP+TPGQCNM+
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLIEQG+
Sbjct  119  VERLGDYLIEQGF 131

Sequence Alignment: 43. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 190.7 bits 740,  Expect = 1e-50
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+IEG  NHL+ AAILG DG+VWAQS  FPQ+KP+E++AI++DF+EPG
Sbjct  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGEPG VIRGKKG GG+ +KKT QAL++GIY EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VER+GDYL+EQG
Sbjct  119  VERIGDYLVEQG 130

Sequence Alignment: 44. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 190.6 bits 740,  Expect = 1e-50
 Identities = 105/132 79%, Positives = 119/132 90%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
            MSWQAYVDDHLMCE+EG   + LT AAI+G DGSVWAQS+ FPQ KP+EIA I++DFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
            G LAPTGL+LGG KYMVIQGEP AVIRGKKG+GG+ +KKTGQALV G+YDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  IVERLGDYLIEQG 132
            IVERLGDYLI+QG
Sbjct  121  IVERLGDYLIDQG 133

Sequence Alignment: 45. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 190.4 bits 739,  Expect = 1e-50
 Identities = 103/132 78%, Positives = 116/132 87%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVD+HLMC IE T NHLT +AI+G+DGS+WAQS++FPQ KP EI AI ++FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGG KYMVIQGEPGAVIRGKKG GG+C+KKT QAL+ GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 46. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 189.9 bits 737,  Expect = 2e-50
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HLT AAI+G DG+ WAQS  FP+FKP+E+AAI++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGEPGAVIRGKKG+GGI VKKTGQ+L++GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 47. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 189.2 bits 734,  Expect = 3e-50
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HL+ AAI+G DG+VWAQS  FPQFKP+E+  I++DFDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAP GL LG TKYMVIQGEPGAVIRGKKG+GGI VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 48. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 189.2 bits 734,  Expect = 3e-50
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEIEG  NHL+ AAI+G +GSVWAQSA FPQ+KP+E+  I+ DF+EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKG GG+ VKK+  AL++GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 49. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 189.2 bits 734,  Expect = 3e-50
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHL CEI+G   HLT AAILG DG VW QS +FPQFKP+EIA I++DFDEPG
Sbjct  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG  L++GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGF 131

Sequence Alignment: 50. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 189.2 bits 734,  Expect = 3e-50
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMCEI+G   HL+ AAILG D +VWAQS +FPQFKP+EI+AI+ DF+ PG
Sbjct  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPG VIRGKKG GGI VKKT  AL++G+YDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLLEQGF 131

Sequence Alignment: 51. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 189.2 bits 734,  Expect = 3e-50
 Identities = 106/132 80%, Positives = 118/132 89%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
            MSWQAYVDDHLMC+IEG  +H LT AAI+G DGSVWAQSA FPQFKP+EI  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
            GTLAPTGLHLGGTKYMVIQGE GAVIRGKKG+GGI +KKT QALV GIY+EPVTPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLIEQG 132
            +V RLGD L++QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 52. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 188.9 bits 733,  Expect = 4e-50
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMCEIEG  +HL  AAI+G DG+VWAQSADFPQFKP+EI  I++D+DEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTG+ +   KYMVIQGEPGAVIRGKKGAGGI +KKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 53. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 188.9 bits 733,  Expect = 4e-50
 Identities = 108/130 83%, Positives = 120/130 92%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC+I+G  N LT AAILG DGSVW+QSA FP F+ +EIAAI++DFD+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGE GAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 54. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 188.9 bits 733,  Expect = 4e-50
 Identities = 102/132 77%, Positives = 117/132 88%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+I+G   HL  A+I+G DGS+WAQSA FPQ+KP+EI  I++DFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL++ GTKYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 55. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 188.6 bits 732,  Expect = 5e-50
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHL CEI+G   HLT AAILG DGSVW +S +FP+FKP+EIA IV+DF+EPG
Sbjct  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG AL++GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLI+QGY
Sbjct  119  VERLGDYLIDQGY 131

Sequence Alignment: 56. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 188.1 bits 730,  Expect = 7e-50
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSW+AYVDDHL CEI+G   +LT AAILG DGSVWAQS +FPQFKP+E A IV+DF+EPG
Sbjct  1    MSWKAYVDDHLCCEIDG--QNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG AL++GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLI+QGY
Sbjct  119  VERLGDYLIDQGY 131

Sequence Alignment: 57. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 187.9 bits 729,  Expect = 8e-50
 Identities = 104/130 80%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVD+HLMCEI+G  +HLT AAILG DGSVWAQS+ FPQFK +EI  I+ DF+EPG
Sbjct  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LG TKYMVIQGEPGAVIRGKKG+GG+ VKKT QAL+ GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 58. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 187.4 bits 727,  Expect = 1e-49
 Identities = 102/132 77%, Positives = 119/132 90%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
            MSWQ YVDDHLMCE++G   + L+ AAI+G DGSVWAQS+ FP+FKP+EI  I+++FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
            G LAPTGL+LGGTKYMVIQGEP AVIRGKKG+GG+ +KKTGQALV G+YDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  IVERLGDYLIEQG 132
            IVERLGDYLIEQG
Sbjct  121  IVERLGDYLIEQG 133

Sequence Alignment: 59. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 187.2 bits 726,  Expect = 1e-49
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAY D+HLMCEIEG  N L  AAI+G DGSVWAQS+ FPQ+KP+EI  ++ DF+EPG
Sbjct  1    MSWQAYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG GG+ VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 60. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 187.2 bits 726,  Expect = 1e-49
 Identities = 99/132 75%, Positives = 116/132 87%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMC+I+G   HLT AAI+G DGS+WAQS+ FPQ+K  EI  I +DF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGLHL GTKYMVIQGEPGAVIRGKKG+GG+ +KKTGQAL+ GIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL++QG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 61. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 186.9 bits 725,  Expect = 2e-49
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC+IEG  N LT AAI+G DGSVWA SA FPQF  +E++AI++DF+EPG
Sbjct  1    MSWQVYVDDHLMCDIEG--NTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL LGGTKYMVIQGEPGAVIRGKKG+GG+ VKKT QAL++G+YDEP+TPGQCNMI
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 62. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 186.9 bits 725,  Expect = 2e-49
 Identities = 100/132 75%, Positives = 118/132 89%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMC+I+G   HL  AAI+G DGSVWAQS++FPQFK +EI+ I++DF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGLHLGGTKYMVIQGE GAVIRGKKG+GG+ +KKT QALV GIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYL++QG
Sbjct  121  VERLGDYLVDQG 132

Sequence Alignment: 63. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 186.4 bits 723,  Expect = 2e-49
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMC++EG  N LT AAILG DGSVWAQSA+FPQ+KP+EI  I  DF EPG
Sbjct  1    MSWQTYVDDHLMCDVEG--NRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL +GGTKYMVIQGEP AVIRGKKGAGG+ +KKT QA+V GIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLIEQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 64. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 185.9 bits 721,  Expect = 3e-49
 Identities = 104/129 80%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HL+CE EG  NHLT AAI+G DG+VWAQSA+FPQFKP+EI  I+ DF  PG
Sbjct  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL+LGGTKYMVIQGEP AVIRGKKG GGI +KKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQ 131
            VERLGDYLIEQ
Sbjct  119  VERLGDYLIEQ 129

Sequence Alignment: 65. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 185.9 bits 721,  Expect = 3e-49
 Identities = 104/129 80%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HL+CE EG  NHLT AAI+G DG+VWAQSA+FPQFKP+EI  I+ DF  PG
Sbjct  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            TLAPTGL+LGGTKYMVIQGEP AVIRGKKG GGI +KKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQ 131
            VERLGDYLIEQ
Sbjct  119  VERLGDYLIEQ 129

Sequence Alignment: 66. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 185.4 bits 719,  Expect = 4e-49
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHL+C+I+G    LT AAI+G DGSVWAQS  FPQ KP+EIAAI++DFDEPG
Sbjct  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGAVIRGKKG+GG+ +KKT  AL++GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYL +QG+
Sbjct  119  VERLGDYLFDQGF 131

Sequence Alignment: 67. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 185.0 bits 717,  Expect = 6e-49
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVD+HLMCEIEG  +HL  AAI+G DG+ WAQS  FP+FK +++A I++DFDEPG
Sbjct  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LG TKYMVIQGEPGAVIRGKKG+GGI VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 68. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 184.9 bits 717,  Expect = 6e-49
 Identities = 100/132 75%, Positives = 116/132 87%, Gaps = 0/132 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMC+I+G  ++   +AI+G DGSVWAQS+ FPQFKP EI  I++DF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGLHLGG KYMVIQGE GAVIRGKKG+GGI +KKTGQALV GIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  121  VERLGDYLIDQG 132

Sequence Alignment: 69. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 183.5 bits 711,  Expect = 2e-48
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HL+CEIEG  +HL+ AAILG DG VWAQS+ FPQFKP+EI AI+ DF EPG
Sbjct  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGA+I GKKG GG+ ++KT QAL++GIYD+P+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+ G
Sbjct  119  VERLGDYLIDTG 130

Sequence Alignment: 70. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 183.2 bits 710,  Expect = 2e-48
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ Y D+HLMCEIEG  N L  AAI+G DGSVWAQS+ FPQ+KP+EI  ++ DF+EPG
Sbjct  1    MSWQTYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGEPGAVIR KKG GG+ VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLIEQG 132
            VERLGDYLI+QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 71. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 178.5 bits 691,  Expect = 5e-47
 Identities = 98/131 74%, Positives = 115/131 87%, Gaps = 1/131 0%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC++ G  N    AAI+G DGSVWAQSA+FPQ+KP+E+  I+ DF+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE GAVIRGKKG+GG  +KKTGQA+V+GIYDEP+TPGQCN++
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  120  VERLGDYLLEQG 131

Sequence Alignment: 72. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 178.2 bits 690,  Expect = 6e-47
 Identities = 100/128 78%, Positives = 111/128 86%, Gaps = 2/128 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ+YVDDHLMC++EG  NHLT AAILG DGSVWAQSA FPQ+KP EI  I +DF+EPG
Sbjct  1    MSWQSYVDDHLMCDVEG--NHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGG KYMVIQGE GAVIRGKKG GG+ +KKT QALV G YDEP+T GQCN++
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLIE 130
            VERLGDYLIE
Sbjct  119  VERLGDYLIE 128

Sequence Alignment: 73. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 178.0 bits 689,  Expect = 7e-47
 Identities = 94/131 71%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVD+HLMC+++G    LT AAILG DGSVWAQSA FP++KP EI AI+ DF+EPG
Sbjct  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
            +LAPTG+++ G KYMVIQGEPG VIRGKKG+GG+ +KK+  AL+ G+YDEP+TPGQCN++
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQGY 133
            VERLGDYLIEQGY
Sbjct  119  VERLGDYLIEQGY 131

Sequence Alignment: 74. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 175.8 bits 680,  Expect = 4e-46
 Identities = 98/130 75%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQAYVDDHLMC++ G  N L  AAI+G DGSVWAQSA+FPQ+KP+E+  I+ DF+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE GAVI GKKG+GG  +KKTGQA+V+GIYDEP+TPGQCN++
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLIEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 159.5 bits 614,  Expect = 2e-41
 Identities = 89/109 81%, Positives = 98/109 89%, Gaps = 2/109 1%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
            MSWQ YVDDHLMCEIEG  N+LT AAI+G DGS+WAQSA FPQFKP+EI AI+ DF EPG
Sbjct  1    MSWQTYVDDHLMCEIEG--NYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEP 111
            TLAPTGL+LGGTKYMVIQGE GAVIRGKKG GG+ VKKT QAL++GIYDEP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 134.8 bits 516,  Expect = 9e-34
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 30/131 22%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQ----------------- 43
            MSWQ YVDDHLMC++EG  +HL  AAILG+DGSVWAQS  FP+                 
Sbjct  1    MSWQTYVDDHLMCDLEG--HHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------FKPDEIAAIVEDFDEPGTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAG 92
                       FKP+EI  I++DFDEPG LAPTGL LGGTKYMVIQGEPGAVIRGKKG+ 
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GICVKKTGQALVMGIYDEPVTPGQCNMIVERLGDYLIEQGY 133
            GI +KKTGQAL+ GIY+EPVTPGQCNM+VE++GDYL++QGY
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 78.8 bits 290,  Expect = 5e-17
 Identities = 50/127 39%, Positives = 77/127 60%, Gaps = 10/127 7%
Query  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGL-DGSVWAQ-SADFP-QFKPDEIAAIVEDF- 56
            MSWQ+YVD+++   ++        A I GL DG+VWA+   D+P Q    E+  I +   
Sbjct  1    MSWQSYVDNQICQHVDCRL-----AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  57   DEPGTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQ 116
              P ++   G+HLGG KY+ IQ +  +++RG+KG+  +C+  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  117  CNMIVERLGDYLIEQGY 133
             N +VE+LGDYL    Y
Sbjct  115  LNNVVEKLGDYLKANNY 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.