The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP
GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV
IVERLGDYLIDQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9XF37 Api g 4 134 915 222.6 2.9e-60
AAL76933 Dau c 4 134 851 207.5 9.9e-56
O24170 Ole e 2 134 798 195.1 5.6e-52
O24171 Ole e 2 134 793 193.9 1.3e-51
O24169 Ole e 2 134 789 192.9 2.4e-51
O49894 Mer a 1 133 784 191.8 5.4e-51
A0A2I4DNN6 Jug r 7.0101 131 772 189.0 3.8e-50
P25816 Bet v 2 133 771 188.7 4.5e-50
Q9AXH4 Cor a 2 131 770 188.5 5.2e-50
XP030492464 Can s 2.0101 133 769 188.2 6.2e-50
Q9M7N0 Hev b 8.0201 131 764 187.1 1.4e-49
QVU02258 Que ac 2.0101 133 764 187.1 1.4e-49
Q9LEI8 Hev b 8.0204 131 763 186.8 1.6e-49
Q9XF38 Pyr c 4 131 761 186.4 2.3e-49
FM164277 Tri a 12.0104 131 758 185.7 3.7e-49
AAL07320 Lit c 1 131 757 185.4 4.3e-49
O24650 Phl p 12.0102 131 756 185.2 5.1e-49
AF377948 Mus a 1.0101 131 755 185.0 6e-49
AAK01235 Cor a 2 131 754 184.7 7.1e-49
CAD37202 Pru p 4.0201 131 754 184.7 7.1e-49
O22655 Zea m 12.0104 131 753 184.5 8.3e-49
Q9XF40 Mal d 4 131 753 184.5 8.3e-49
P49233 Tri a 12.0102 141 753 184.5 9e-49
QRN65366 Lig v 2.0101 134 752 184.3 1e-48
P49234 Tri a 12.0103 140 752 184.2 1e-48
Q9M7M8 Hev b 8.0203 131 751 184.0 1.2e-48
O04725 Cyn d 12 131 751 184.0 1.2e-48
Q9XF42 Mal d 4 131 749 183.5 1.6e-48
CAA54686 Phl p 12.0101 131 749 183.5 1.6e-48
P35081 Zea m 12.0101 131 749 183.5 1.6e-48
Q9XF41 Mal d 4 131 749 183.5 1.6e-48
P35079 Phl p 12.0101 131 749 183.5 1.6e-48
QID21357 Pop n 2.0101 131 749 183.5 1.6e-48
Q9FUD1 Ory s 12.0101 131 746 182.8 2.6e-48
Q9FR39 Zea m 12.0105 131 745 182.6 3.1e-48
Q9STB6 Hev b 8.0102 131 744 182.4 3.6e-48
P49232 Tri a 12.0101 138 743 182.1 4.5e-48
P52184 Hor v 12.0101 131 742 181.9 5e-48
AAP13533 Cuc m 2 131 742 181.9 5e-48
ABU95412 Sin a 4.0101 131 740 181.4 6.9e-48
Q9M7M9 Hev b 8.0202 131 740 181.4 6.9e-48
Q5XWE1 Citr l 2.0101 131 740 181.4 6.9e-48
ACP43298 Ama r 2.0101 133 740 181.4 7e-48
O24282 Phl p 12.0103 131 739 181.2 8.1e-48
Q8L5D8 Pho d 2.0101 131 738 181.0 9.6e-48
P35082 Zea m 12.0102 131 737 180.7 1.1e-47
CAD37201 Pru p 4.0101 131 737 180.7 1.1e-47
P35083 Zea m 12.0103 131 733 179.8 2.2e-47
O65809 Gly m 3 131 732 179.6 2.5e-47
AY081850 Pru du 4.0101 131 731 179.3 3e-47
AY081852 Pru du 4.0102 131 731 179.3 3e-47
Q9XF39 Pru av 4 131 730 179.1 3.5e-47
O65810 Gly m 3 131 729 178.8 4.2e-47
CAD10376 Cap a 2 131 728 178.6 4.9e-47
Q9XG85 Par j 3 132 724 177.7 9.5e-47
AAL92870 Che a 2 131 723 177.4 1.1e-46
A0A023W2L7 Pro j 2.0101 133 722 177.2 1.3e-46
A0A0A0REA1 Koc s 2.0101 133 720 176.7 1.8e-46
AAL29690 Lyc e 1 131 719 176.5 2.1e-46
A0A0A0RCW1 Aca f 2 133 717 176.0 3e-46
O81982 Hel a 2 133 716 175.8 3.5e-46
P84177 Cit s 2.0101 131 714 175.3 4.8e-46
AJ421030 Art v 4.0101 133 714 175.3 4.9e-46
CAD10377 Lyc e 1 131 713 175.1 5.6e-46
Q93YG7 Sola l 1.0101 131 713 175.1 5.6e-46
ACS34771 Sal k 4.0101 133 712 174.9 6.7e-46
Q9T0M8 Par j 3 131 711 174.6 7.8e-46
AAK54835 Ana c 1 131 710 174.4 9.2e-46
O65812 Hev b 8.0101 131 708 173.9 1.3e-45
Q42449 Ara t 8 131 704 173.0 2.4e-45
ADK22841 Sal k 4.0201 133 703 172.7 2.9e-45
AJ421031 Art v 4.0201 133 700 172.0 4.7e-45
Q5EF31 Cro s 1.0101 131 699 171.8 5.5e-45
Q9SQI9 Ara h 5 131 697 171.3 7.6e-45
FG438715 Act d 9.0101 109 598 148.1 6.4e-38
QEQ43417 Sola m 1.0101 159 526 131.1 1.2e-32
A0A1B2YLJ4 Tyr p 36.0101 131 259 68.4 7.4e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 222.6 bits 915,  Expect = 3e-60
 Identities = 134/134 100%, Positives = 134/134 100%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 2. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 207.5 bits 851,  Expect = 1e-55
 Identities = 122/134 91%, Positives = 128/134 95%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMCEV+GNPGQ L+AAAIIGHDGSVWAQSSTFP+ KPEEI GIMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGLYLGG KYMVIQGEP AVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 3. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 195.1 bits 798,  Expect = 6e-52
 Identities = 110/134 82%, Positives = 126/134 94%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC++EG+ G+ LTAAAI+GHDGSVWAQS+TFPQ KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 4. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 193.9 bits 793,  Expect = 1e-51
 Identities = 109/134 81%, Positives = 125/134 93%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC++EG+ G+ LTAAAI+GHDGSVWAQS+TFPQ KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  121  IVERLGDYLIDQGL 134
            + ERLGDYL++QGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 5. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 192.9 bits 789,  Expect = 2e-51
 Identities = 108/134 80%, Positives = 125/134 93%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC++EG+  + LTAAAI+GHDGSVWAQS+TFPQ KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 6. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 191.8 bits 784,  Expect = 5e-51
 Identities = 107/133 80%, Positives = 124/133 93%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+++G  GQ L AA+I+GHDGS+WAQS++FPQ+KPEEI GIMKDFDEP
Sbjct  1    MSWQTYVDDHLMCDIDGQ-GQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGLY+ G KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  60   GHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QG+
Sbjct  120  VVERLGDYLIEQGM 133

Sequence Alignment: 7. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 189.0 bits 772,  Expect = 4e-50
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE++G   Q LTAAAIIGHDGSVWAQSS+FPQ KPEEIA IMKDFDEP
Sbjct  1    MSWQTYVDEHLMCEIDG---QHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKG+GG+T+KKTGQAL+FG+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QGL
Sbjct  118  IVERLGDYLVEQGL 131

Sequence Alignment: 8. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 188.7 bits 771,  Expect = 5e-50
 Identities = 107/133 80%, Positives = 123/133 92%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMC+++G    +L A+AI+GHDGSVWAQSS+FPQ KP+EI GIMKDF+EP
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSL-ASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+TIKKTGQALVFG+Y+EPVTPGQCN+
Sbjct  60   GHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLIDQGL
Sbjct  120  VVERLGDYLIDQGL 133

Sequence Alignment: 9. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 188.5 bits 770,  Expect = 5e-50
 Identities = 110/131 83%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAY D+HLMCE+EGN    L AAAIIGHDGSVWAQSSTFPQ+KPEEI G+M DF+EP
Sbjct  1    MSWQAYGDEHLMCEIEGN---RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GGVT+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 10. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 188.2 bits 769,  Expect = 6e-50
 Identities = 107/133 80%, Positives = 123/133 92%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMC+++G  GQ LTAAAIIGHDGS+WAQSS+FPQ+K +EI  I KDF+EP
Sbjct  1    MSWQTYVDEHLMCDIDGQ-GQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+L G KYMVIQGEP AVIRGKKGSGGVTIKKTGQAL+FG+Y+EPVTPGQCN+
Sbjct  60   GHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL+DQGL
Sbjct  120  VVERLGDYLVDQGL 133

Sequence Alignment: 11. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 187.1 bits 764,  Expect = 1e-49
 Identities = 106/131 80%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMC+++G   + LTAAAIIGHDGSVWAQSS+FPQ KPEE+A IMKDFDEP
Sbjct  1    MSWQTYVDEHLMCDIDG---HHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKGSGG+T+KKTGQAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 12. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 187.1 bits 764,  Expect = 1e-49
 Identities = 109/133 81%, Positives = 121/133 90%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMC+++G  GQ L AAAIIGHDGSVWAQSS FPQ K EEI+ IMKDF+EP
Sbjct  1    MSWQTYVDEHLMCDIDGQ-GQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGE  AVIRGKKGSGGVTIKKT QALVFG+Y+EPVTPGQCN+
Sbjct  60   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL+DQGL
Sbjct  120  VVERLGDYLVDQGL 133

Sequence Alignment: 13. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 186.8 bits 763,  Expect = 2e-49
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+++G   + LTAAAIIGHDGSVWAQSS+FPQ K +E+A +MKDFDEP
Sbjct  1    MSWQTYVDDHLMCDIDG---HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKGSGG+T+KKTGQAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL+DQGL
Sbjct  118  IVERLGDYLLDQGL 131

Sequence Alignment: 14. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 186.4 bits 761,  Expect = 2e-49
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+++G   + LTAAAI+GHDGSVWAQSSTFP+ KPEEI  IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCDIDG---HHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGGVT+KKT QALVFG+Y+EP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 15. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 185.7 bits 758,  Expect = 4e-49
 Identities = 105/130 80%, Positives = 121/130 93%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSW+AYVDDHL CE++G   Q LT+AAI+GHDGSVWAQS  FPQ KPEEIAGI+KDF+EP
Sbjct  1    MSWKAYVDDHLCCEIDG---QHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG AL++G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQG 133
            +VERLGDYLIDQG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 16. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 185.4 bits 757,  Expect = 4e-49
 Identities = 107/131 81%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMCE +G   Q LTAAAIIGHDGSVWAQS+ FPQ KP EIA IMKDFDEP
Sbjct  1    MSWQTYVDDHLMCETDG---QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKG GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL+DQGL
Sbjct  118  VVERLGDYLVDQGL 131

Sequence Alignment: 17. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 185.2 bits 756,  Expect = 5e-49
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + L +AAI+GHDG+VWAQS+ FPQ KPEEI GIMKDFDEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTG+++ GAKYMVIQGEP AVIRGKKG+GG+TIKKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 18. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 185.0 bits 755,  Expect = 6e-49
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHL+C+++G   Q LTAAAI+GHDGSVWAQS  FPQ KPEEIA IMKDFDEP
Sbjct  1    MSWQAYVDDHLLCDIDG---QCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKGSGGVTIKKT  AL+ G+Y+EP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL DQG+
Sbjct  118  VVERLGDYLFDQGF 131

Sequence Alignment: 19. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 184.7 bits 754,  Expect = 7e-49
 Identities = 108/131 82%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ Y D+HLMCE+EGN    L AAAIIGHDGSVWAQSSTFPQ+KPEEI G+M DF+EP
Sbjct  1    MSWQTYGDEHLMCEIEGN---RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIR KKG GGVT+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 20. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 184.7 bits 754,  Expect = 7e-49
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE+EGN    L+AAAIIGHDGSVWAQS+TFPQ+KPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCEIEGNH---LSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GGVT+KK+  AL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QGL
Sbjct  118  IVERLGDYLVEQGL 131

Sequence Alignment: 21. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 184.5 bits 753,  Expect = 8e-49
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVD+HLMCE+EG   Q L+AAAI+GHDGSVWAQS +FP++KPEE+AGI+KDFDEP
Sbjct  1    MSWQAYVDEHLMCEIEG---QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL++GG KYMVIQGEP  VIRGKKG+GG+TIKKTG +L+ GVYDEP+TPGQCN+
Sbjct  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QG+
Sbjct  118  VVERLGDYLIEQGF 131

Sequence Alignment: 22. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 184.5 bits 753,  Expect = 8e-49
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDD LMC+++G   + LTAAAI+GHDGSVWA+SSTFP+ KPEEI  IMKDFDEP
Sbjct  1    MSWQAYVDDRLMCDIDG---HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGGVT+KKTGQALVFG+Y+EP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 23. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 184.5 bits 753,  Expect = 9e-49
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHL CE++G   Q LT+AAI+GHDGSVWA+S  FP+ KPEEIAGI+KDF+EP
Sbjct  1    MSWQAYVDDHLCCEIDG---QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG AL++G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQG 133
            +VERLGDYLIDQG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 24. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 184.3 bits 752,  Expect = 1e-48
 Identities = 105/134 78%, Positives = 120/134 89%, Gaps = 0/134 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC++EG+  + LTAAAI+GHDGSVWAQS+TFPQ KPEEI GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+TIKKT QALVFG+Y+EPVTPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  121  IVERLGDYLIDQGL 134
            +V RLGD L+ QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 25. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 184.2 bits 752,  Expect = 1e-48
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSW+AYVDDHL CE++G   Q LT+AAI+GHDGSVWAQS  FPQ KPEE AGI+KDF+EP
Sbjct  1    MSWKAYVDDHLCCEIDG---QNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG AL++G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQG 133
            +VERLGDYLIDQG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 26. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 184.0 bits 751,  Expect = 1e-48
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+++G   + LTAAAIIGHDGSVWAQSS FPQ K +E+A +MKDFDEP
Sbjct  1    MSWQTYVDDHLMCDIDG---HRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKGSGG+T+KKTGQAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 27. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 184.0 bits 751,  Expect = 1e-48
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE+EG   + LT+AAIIGHDG+VWAQS+ FP  KPEE+A IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEIEG---HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LG  KYMVIQGEP AVIRGKKGSGGVT+KKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            ++E+LGDYLI+QG+
Sbjct  118  VIEKLGDYLIEQGM 131

Sequence Alignment: 28. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 183.5 bits 749,  Expect = 2e-48
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+++GN    LTAAAI+G+DGSVW+QS++FP  KPEEIA I+KDFD+P
Sbjct  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKGSGG+TIKKT QAL+ G+YDEPVTPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNI 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QGL
Sbjct  118  VVERLGDYLIEQGL 131

Sequence Alignment: 29. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 183.5 bits 749,  Expect = 2e-48
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + L +AAI+GHDG+VWAQS+ FPQ KPEEI GIMKDFDEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTG+++ GAKYMVIQGEP  VIRGKKG+GG+TIKKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 30. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 183.5 bits 749,  Expect = 2e-48
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + LT+AAI+GHDG+ WAQS+ FP+ KPEE+A IMKDFDEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL LGG KYMVIQGEP AVIRGKKGSGG+T+KKTGQ+L+ G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLLEQGM 131

Sequence Alignment: 31. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 183.5 bits 749,  Expect = 2e-48
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE+EGN    L+AAAIIGH+GSVWAQS+TFPQ+KPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCEIEGNH---LSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP  VIRGKKG GGVT+KK+  AL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QGL
Sbjct  118  VVERLGDYLIEQGL 131

Sequence Alignment: 32. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 183.5 bits 749,  Expect = 2e-48
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + L +AAI+GHDG+VWAQS+ FPQ KPEEI GIMKDFDEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTG+++ GAKYMVIQGEP  VIRGKKG+GG+TIKKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 33. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 183.5 bits 749,  Expect = 2e-48
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC++EGN   TLT+AAIIGHDGSVWA S++FPQ   EE++ IMKDF+EP
Sbjct  1    MSWQVYVDDHLMCDIEGN---TLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKGSGGVT+KKT QAL+ GVYDEP+TPGQCN+
Sbjct  58   GSLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 34. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 182.8 bits 746,  Expect = 3e-48
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + LT+AAI+GHDG+VWAQS+ FPQ KPEE+  IMKDFDEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QGL
Sbjct  118  VVERLGDYLVEQGL 131

Sequence Alignment: 35. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 182.6 bits 745,  Expect = 3e-48
 Identities = 100/131 76%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHL+C++EG   Q L+AAAI+GHDGSVWAQS  FP++KPEE+AG++KDFDEP
Sbjct  1    MSWQAYVDDHLLCDIEG---QHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL++GG KYMVIQGEP  VIRGKKG+GG+TIKKTG +L+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QG+
Sbjct  118  VVERLGDYLIEQGF 131

Sequence Alignment: 36. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 182.4 bits 744,  Expect = 4e-48
 Identities = 107/130 82%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE+EGN    L+AAAIIG+DGSVWAQS+ FPQ K EEI GIM DF EP
Sbjct  1    MSWQAYVDDHLMCEIEGNH---LSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLY+GG KYMVIQGEP AVIRGKKG GGVT+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQG 133
            IVERLGDYLIDQG
Sbjct  118  IVERLGDYLIDQG 130

Sequence Alignment: 37. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 182.1 bits 743,  Expect = 4e-48
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHL CE++G   Q LT+AAI+GHDGSVW +S  FP+ KPEEIAGI+KDF+EP
Sbjct  1    MSWQTYVDDHLCCEIDG---QHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG AL++G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQG 133
            +VERLGDYLIDQG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 38. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 181.9 bits 742,  Expect = 5e-48
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHL CE++G   Q LT+AAI+GHDG VW QS  FPQ KPEEIAGI+KDFDEP
Sbjct  1    MSWQTYVDDHLCCEIDG---QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG  L++G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLVEQGF 131

Sequence Alignment: 39. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 181.9 bits 742,  Expect = 5e-48
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EGN    LT+AAIIG+DGSVWAQS  FPQ+KPEE+AGI+ DF +P
Sbjct  1    MSWQVYVDEHLMCEIEGNH---LTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLY+GG KYMVIQGEP AVIRGKKG GGVT+KKTG ALV G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLIDQGL
Sbjct  118  IVERLGDYLIDQGL 131

Sequence Alignment: 40. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 181.4 bits 740,  Expect = 7e-48
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+VEGN    LTAAAI+G+DGSVWAQS+ FPQ+KPEEI GI  DF EP
Sbjct  1    MSWQTYVDDHLMCDVEGN---RLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL++GG KYMVIQGEPNAVIRGKKG+GGVTIKKT QA+VFG+Y+EP+TPGQCN+
Sbjct  58   GTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QGL
Sbjct  118  VVERLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 181.4 bits 740,  Expect = 7e-48
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+++G   + LTAAAIIGHDGSVWAQSS+FPQ K +E+A IMKDFDEP
Sbjct  1    MSWQTYVDDHLMCDIDG---HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 42. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 181.4 bits 740,  Expect = 7e-48
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE+EGN    LT+AAIIG+DGSVWA+S  FPQ+KPEEI GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCEIEGNH---LTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLY+GG+KYMVIQGEP AVIRGKKG GGVT+KKT  ALV G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 181.4 bits 740,  Expect = 7e-48
 Identities = 105/132 79%, Positives = 119/132 90%, Gaps = 1/132 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE+EG   + LT AAI+G DGSVWAQS+ FPQ KP+EIA I++DFDEP
Sbjct  1    MSWQAYVDDHLMCEIEGTTNH-LTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP AVIRGKKG+GG+ +KKTGQALV G+YDEPVTPGQCN+
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNM 119
Query  121  IVERLGDYLIDQG 133
            IVERLGDYLI+QG
Sbjct  120  IVERLGDYLIEQG 132

Sequence Alignment: 44. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 181.2 bits 739,  Expect = 8e-48
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + L +AAI GHDG+VWAQS+ FPQ KPEEI GIMKD+DEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTG+++  AKYMVIQGEP AVIRGKKG+GG+TIKKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLVEQGM 131

Sequence Alignment: 45. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 181.0 bits 738,  Expect = 1e-47
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVD+HLMCE++G   + LTAAAI+GHDGSVWAQSS+FPQ K EEI  IM DF+EP
Sbjct  1    MSWQAYVDEHLMCEIDG---HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLG  KYMVIQGEP AVIRGKKGSGGVT+KKT QAL+FG+Y+EP+TPGQCN+
Sbjct  58   GSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QG+
Sbjct  118  VVERLGDYLIEQGM 131

Sequence Alignment: 46. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 180.7 bits 737,  Expect = 1e-47
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVD+HLMCE+EG   + L AAAI+GHDG+ WAQS+ FP+ K E++A IMKDFDEP
Sbjct  1    MSWQAYVDEHLMCEIEG---HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            GHLAPTGL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLLEQGM 131

Sequence Alignment: 47. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 180.7 bits 737,  Expect = 1e-47
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+++GN    LTAAAI+G+DGSVW+QS+TFP  KPEEIA I+KDFD+P
Sbjct  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 48. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 179.8 bits 733,  Expect = 2e-47
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMCE+EG   + L++AAI+GHDG+VWAQS+ FPQ KPEE+  I+KDFDEP
Sbjct  1    MSWQTYVDEHLMCEIEG---HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAP GL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QGL
Sbjct  118  VVERLGDYLVEQGL 131

Sequence Alignment: 49. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 179.6 bits 732,  Expect = 3e-47
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHL+C++EGN    LT AAIIG+DGSVWAQS+ FPQ KPEEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLLCDIEGNH---LTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GGVT+KKTG AL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQG 133
            +VER GDYLIDQG
Sbjct  118  VVERPGDYLIDQG 130

Sequence Alignment: 50. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 179.3 bits 731,  Expect = 3e-47
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+++GN    LTAAAI+G+DGSVW+QS+TFP  KPEEIA I+KDFD+P
Sbjct  1    MSWQQYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 51. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 179.3 bits 731,  Expect = 3e-47
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC+++GN    LTAAAI+G+DGSVW+QS+TFP  KPEEIA I+KDFD+P
Sbjct  1    MSWQQYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 52. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 179.1 bits 730,  Expect = 4e-47
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+++GN    LTAAAI+G+DGSVW+QS+TFP  KPEEIA I+KD+D+P
Sbjct  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 178.8 bits 729,  Expect = 4e-47
 Identities = 104/130 80%, Positives = 115/130 88%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHL+C +EGN    LT AAIIG+DGSVW QS+ FPQ KPEEI  IM DF+EP
Sbjct  1    MSWQAYVDDHLLCGIEGNH---LTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GGVT+KKTG AL+ G+YDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQG 133
            +VERLGDYLIDQG
Sbjct  118  VVERLGDYLIDQG 130

Sequence Alignment: 54. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 178.6 bits 728,  Expect = 5e-47
 Identities = 105/131 80%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMCE+EGN    LT+AAIIG+DGSVWAQS+TFPQ KPEEI  IM DF EP
Sbjct  1    MSWQTYVDDHLMCEIEGN---RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGE  AVIRGKKG GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+Q L
Sbjct  118  IVERLGDYLIEQSL 131

Sequence Alignment: 55. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 177.7 bits 724,  Expect = 9e-47
 Identities = 103/132 78%, Positives = 119/132 90%, Gaps = 2/132 1%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+V G+ G T  +AAIIGHDGSVWAQS+ FPQ+KPEE+ GIM DF+E 
Sbjct  1    MSWQAYVDDHLMCDV-GD-GNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEA 58
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG T+KKTGQA+V G+YDEP+TPGQCN+
Sbjct  59   GFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 118
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QGL
Sbjct  119  VVERLGDYLLEQGL 132

Sequence Alignment: 56. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 177.4 bits 723,  Expect = 1e-46
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC++EGN    L++AAI+GHDG+VWAQS +FPQ+KPEE++ IMKDF+EP
Sbjct  1    MSWQTYVDDHLMCDIEGNH---LSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP  VIRGKKG GGVTIKKT QAL+ G+Y EP+TPGQCN+
Sbjct  58   GSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VER+GDYL++QG+
Sbjct  118  VVERIGDYLVEQGM 131

Sequence Alignment: 57. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 177.2 bits 722,  Expect = 1e-46
 Identities = 99/133 74%, Positives = 118/133 88%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMCE+EG   + L+AAAI+G DGSVWAQS++FPQ KP+EI+ ++KDFD P
Sbjct  1    MSWQTYVDDHLMCEIEGTNNH-LSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP  VIRGKKG GG+ +KKTGQAL+ G+YDEPVTPGQCN+
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 58. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 176.7 bits 720,  Expect = 2e-46
 Identities = 100/133 75%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC++EG   + LT AAI+G DGSVWAQS+ FPQ KP+EIA I+K+FDEP
Sbjct  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE   VIRGKKG GG+ +KKTGQAL+FG+YDEPVTPGQCN+
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 59. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 176.5 bits 719,  Expect = 2e-46
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC++EGN    LT+AAIIG+DGSVWAQS+ FPQ KPEEI  IM DF EP
Sbjct  1    MSWQTYVDDHLMCDIEGNH---LTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKG+GG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDY+I+QGL
Sbjct  118  IVERLGDYIIEQGL 131

Sequence Alignment: 60. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 176.0 bits 717,  Expect = 3e-46
 Identities = 99/133 74%, Positives = 116/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            M WQ YVDDHLMCE+EG   + L+ AAI+G DGSVWAQS++FPQ KP+EIA ++KDFD P
Sbjct  1    MCWQTYVDDHLMCEIEGTNNH-LSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGEP   IRGKKG GG+ +KKTGQALVFG+YDEPVTPGQCN+
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 61. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 175.8 bits 716,  Expect = 4e-46
 Identities = 96/133 72%, Positives = 120/133 90%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVD+HLMC++EG  GQ LT+AAI+G DG+VWAQS+ FPQ KPEE+ GI+K+FDE 
Sbjct  1    MSWQAYVDEHLMCDIEGT-GQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTG+++ GAKYMV+QGEP AVIRGKKG+GG+ IKKTGQA++ G+YDEPV PGQCN+
Sbjct  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  120  VVERLGDYLLEQGM 133

Sequence Alignment: 62. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 175.3 bits 714,  Expect = 5e-46
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+++GN    LTAAAI+G+DGSVW+QS+TFP  + EEIA I+KDFD+P
Sbjct  1    MSWQAYVDDHLMCDIDGN---RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKGSGG+ +KKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+QGL
Sbjct  118  IVERLGDYLIEQGL 131

Sequence Alignment: 63. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 175.3 bits 714,  Expect = 5e-46
 Identities = 98/133 73%, Positives = 119/133 89%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC++EG  GQ LT+AAI G DG+VWA+S++FP+ KP EI  I+K+F+E 
Sbjct  1    MSWQTYVDDHLMCDIEGT-GQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEA 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G+LAPTGL+LGGAKYMVIQGE  AVIRGKKG+GG+ IKKTGQA+VFG+YDEPV PGQCN+
Sbjct  60   GQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL+DQG+
Sbjct  120  VVERLGDYLLDQGM 133

Sequence Alignment: 64. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 175.1 bits 713,  Expect = 6e-46
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HL+CE EGN    LT+AAIIG+DG+VWAQS+ FPQ KPEEI GIM DF  P
Sbjct  1    MSWQTYVDEHLLCENEGNH---LTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GG+TIKKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+Q L
Sbjct  118  IVERLGDYLIEQSL 131

Sequence Alignment: 65. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 175.1 bits 713,  Expect = 6e-46
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HL+CE EGN    LT+AAIIG+DG+VWAQS+ FPQ KPEEI GIM DF  P
Sbjct  1    MSWQTYVDEHLLCENEGNH---LTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP AVIRGKKG GG+TIKKT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLI+Q L
Sbjct  118  IVERLGDYLIEQSL 131

Sequence Alignment: 66. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 174.9 bits 712,  Expect = 7e-46
 Identities = 99/133 74%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMCE+EG   + LTAAAI+G DGSVWAQS+ FPQ KP+EI+ ++K+FDE 
Sbjct  1    MSWQTYVDDHLMCEIEGTNNH-LTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEA 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE   VIRGKKG GG+ +KKTGQAL+FG+YDEPVTPGQCN+
Sbjct  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  120  IVERLGDYLVEQGM 133

Sequence Alignment: 67. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 174.6 bits 711,  Expect = 8e-46
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMC+V G+ G TL +AAIIGHDGSVWAQS+ FPQ+KPEE+ GIM DF+E 
Sbjct  1    MSWQAYVDDHLMCDV-GD-GNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEG 58
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVI GKKGSGG T+KKTGQA+V G+YDEP+TPGQCN+
Sbjct  59   GFLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLLEQGM 131

Sequence Alignment: 68. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 174.4 bits 710,  Expect = 9e-46
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVDDHLMCE++G   Q L++AAI+GHD +VWAQS  FPQ KPEEI+ I+ DF+ P
Sbjct  1    MSWQAYVDDHLMCEIDG---QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP  VIRGKKG+GG+T+KKT  AL+ GVYDEP+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYL++QG+
Sbjct  118  VVERLGDYLLEQGF 131

Sequence Alignment: 69. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 173.9 bits 708,  Expect = 1e-45
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+ LMCE+EGN    LTAAAIIG+DGSVWAQSS FPQ K EEI  IM DFDEP
Sbjct  1    MSWQTYVDERLMCEIEGNH---LTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKG GGVT++KT QAL+ G+YDEP+TPGQCN+
Sbjct  58   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL++QG+
Sbjct  118  IVERLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 173.0 bits 704,  Expect = 2e-45
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ+YVDDHLMC+VEGN    LTAAAI+G+DGSVWAQS+ FPQ+KP+EI GI KDF+EP
Sbjct  1    MSWQSYVDDHLMCDVEGNH---LTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGG KYMVIQGE  AVIRGKKG GGVTIKKT QALVFG YDEP+T GQCN+
Sbjct  58   GFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNL 117
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+  L
Sbjct  118  VVERLGDYLIESEL 131

Sequence Alignment: 71. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 172.7 bits 703,  Expect = 3e-45
 Identities = 99/133 74%, Positives = 115/133 86%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQAYVD+HLMC +E + G  LT++AI+G DGS+WAQSS FPQ+KP+EI  I K+FD P
Sbjct  1    MSWQAYVDEHLMCNIE-DTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGP 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
              LAPTGL+LGG KYMVIQGEP AVIRGKKG GGV IKKT QAL+FG+YDEPV PGQCN+
Sbjct  60   NTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            +VERLGDYLI+QGL
Sbjct  120  VVERLGDYLIEQGL 133

Sequence Alignment: 72. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 172.0 bits 700,  Expect = 5e-45
 Identities = 97/133 72%, Positives = 116/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMC++EG  GQ LTAAAI+G DG+VWA+S  FP+ KPEE+ GI+ +F+E 
Sbjct  1    MSWQTYVDDHLMCDIEGT-GQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEV 59
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGL+LGGAKYMV+QGE  AVIRGKKG+GG+ IKKTGQA+V G+YDEPV PGQCN+
Sbjct  60   GTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNM 119
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYL+DQ +
Sbjct  120  IVERLGDYLVDQNM 133

Sequence Alignment: 73. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 171.8 bits 699,  Expect = 6e-45
 Identities = 96/130 73%, Positives = 117/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HLMC+++G   + LT+AAI+GHDGSVWAQS+ FP++KP EI  I+ DF+EP
Sbjct  1    MSWQTYVDEHLMCDMDG---HVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTG+Y+ GAKYMVIQGEP  VIRGKKGSGGVTIKK+  AL+FG+YDEP+TPGQCN+
Sbjct  58   GSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNL 117
Query  121  IVERLGDYLIDQG 133
            +VERLGDYLI+QG
Sbjct  118  VVERLGDYLIEQG 130

Sequence Alignment: 74. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 171.3 bits 697,  Expect = 8e-45
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 3/131 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVD+HL+CE+EG+    L++AAI+G+DG VWAQSS FPQ KPEEI  IM DF EP
Sbjct  1    MSWQTYVDNHLLCEIEGDH---LSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
            G LAPTGLYLGG KYMVIQGEP A+I GKKG GGVTI+KT QAL+ G+YD+P+TPGQCN+
Sbjct  58   GSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNM 117
Query  121  IVERLGDYLIDQGL 134
            IVERLGDYLID GL
Sbjct  118  IVERLGDYLIDTGL 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 148.1 bits 598,  Expect = 6e-38
 Identities = 86/109 78%, Positives = 95/109 87%, Gaps = 3/109 2%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
            MSWQ YVDDHLMCE+EGN    LT+AAIIG+DGS+WAQS++FPQ KPEEI  IM DF EP
Sbjct  1    MSWQTYVDDHLMCEIEGN---YLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEP 57
Query  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEP 112
            G LAPTGLYLGG KYMVIQGE  AVIRGKKG GGVT+KKT QAL+ G+YDEP
Sbjct  58   GTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 131.1 bits 526,  Expect = 1e-32
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 31/130 23%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQ---------------- 44
            MSWQ YVDDHLMC++EG   + L +AAI+G DGSVWAQS  FP+                
Sbjct  1    MSWQTYVDDHLMCDLEG---HHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNC 57
Query  45   ------------IKPEEIAGIMKDFDEPGHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGS 92
                         KPEEI  IMKDFDEPG LAPTGL+LGG KYMVIQGEP AVIRGKKGS
Sbjct  58   YIMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGS 117
Query  93   GGVTIKKTGQALVFGVYDEPVTPGQCNVIVERLGDYLIDQG 133
             G+TIKKTGQAL+FG+Y+EPVTPGQCN++VE++GDYL+DQG
Sbjct  118  SGITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 68.4 bits 259,  Expect = 7e-14
 Identities = 50/122 40%, Positives = 75/122 61%, Gaps = 11/122 9%
Query  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIG-HDGSVWAQ-SSTFP-QIKPEEIAGIMKDF 57
            MSWQ+YVD+++   V+         A I G +DG+VWA+    +P QI  +E+  I    
Sbjct  1    MSWQSYVDNQICQHVD------CRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAI 54
Query  58   -DEPGHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPG 116
               P  +   G++LGG KY+ IQ + N+++RG+KGS  + I  T   L+     +   PG
Sbjct  55   RSNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPG 113
Query  117  QCNVIVERLGDYL 129
            Q N +VE+LGDYL
Sbjct  114  QLNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.