The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG
TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV
VERLGDYLLEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
O81982 Hel a 2 133 907 239.3 2.7e-65
AJ421031 Art v 4.0201 133 819 216.7 1.7e-58
AJ421030 Art v 4.0101 133 796 210.8 9.9e-57
ACP43298 Ama r 2.0101 133 774 205.2 5e-55
O24650 Phl p 12.0102 131 769 203.9 1.2e-54
CAA54686 Phl p 12.0101 131 762 202.1 4.1e-54
P35079 Phl p 12.0101 131 762 202.1 4.1e-54
ACS34771 Sal k 4.0101 133 761 201.8 5e-54
A0A0A0REA1 Koc s 2.0101 133 758 201.1 8.5e-54
A0A023W2L7 Pro j 2.0101 133 752 199.5 2.5e-53
O24282 Phl p 12.0103 131 750 199.0 3.5e-53
O49894 Mer a 1 133 743 197.2 1.2e-52
ADK22841 Sal k 4.0201 133 741 196.7 1.8e-52
A0A0A0RCW1 Aca f 2 133 734 194.9 6.1e-52
Q9M7N0 Hev b 8.0201 131 733 194.7 7.1e-52
Q9FUD1 Ory s 12.0101 131 732 194.4 8.5e-52
O04725 Cyn d 12 131 726 192.9 2.5e-51
O22655 Zea m 12.0104 131 723 192.1 4.2e-51
Q9FR39 Zea m 12.0105 131 719 191.1 8.6e-51
O24170 Ole e 2 134 719 191.1 8.8e-51
A0A2I4DNN6 Jug r 7.0101 131 717 190.6 1.2e-50
P35083 Zea m 12.0103 131 717 190.6 1.2e-50
P35081 Zea m 12.0101 131 716 190.3 1.5e-50
Q9XF37 Api g 4 134 716 190.3 1.5e-50
O24169 Ole e 2 134 716 190.3 1.5e-50
O24171 Ole e 2 134 714 189.8 2.2e-50
Q9XF42 Mal d 4 131 711 189.0 3.6e-50
XP030492464 Can s 2.0101 133 710 188.8 4.3e-50
FM164277 Tri a 12.0104 131 707 188.0 7.3e-50
AAL76933 Dau c 4 134 705 187.5 1.1e-49
AAL29690 Lyc e 1 131 704 187.2 1.2e-49
Q5XWE1 Citr l 2.0101 131 703 187.0 1.5e-49
AAP13533 Cuc m 2 131 703 187.0 1.5e-49
P52184 Hor v 12.0101 131 703 187.0 1.5e-49
Q9STB6 Hev b 8.0102 131 702 186.7 1.8e-49
P49233 Tri a 12.0102 141 702 186.7 1.9e-49
P35082 Zea m 12.0102 131 701 186.5 2.1e-49
CAD37201 Pru p 4.0101 131 701 186.5 2.1e-49
Q9M7M8 Hev b 8.0203 131 701 186.5 2.1e-49
ABU95412 Sin a 4.0101 131 700 186.2 2.5e-49
QVU02258 Que ac 2.0101 133 700 186.2 2.6e-49
AAL07320 Lit c 1 131 698 185.7 3.6e-49
Q9LEI8 Hev b 8.0204 131 695 184.9 6.1e-49
AY081852 Pru du 4.0102 131 695 184.9 6.1e-49
AY081850 Pru du 4.0101 131 695 184.9 6.1e-49
Q9XF39 Pru av 4 131 694 184.7 7.3e-49
P49234 Tri a 12.0103 140 694 184.6 8e-49
AAL92870 Che a 2 131 693 184.4 8.7e-49
Q9XG85 Par j 3 132 693 184.4 8.8e-49
P49232 Tri a 12.0101 138 692 184.1 1.1e-48
Q8L5D8 Pho d 2.0101 131 691 183.9 1.2e-48
O65809 Gly m 3 131 691 183.9 1.2e-48
Q9XF38 Pyr c 4 131 691 183.9 1.2e-48
AAK54835 Ana c 1 131 690 183.6 1.5e-48
CAD37202 Pru p 4.0201 131 689 183.4 1.8e-48
Q9M7M9 Hev b 8.0202 131 688 183.1 2.1e-48
QRN65366 Lig v 2.0101 134 688 183.1 2.2e-48
Q93YG7 Sola l 1.0101 131 687 182.9 2.5e-48
CAD10377 Lyc e 1 131 687 182.9 2.5e-48
P25816 Bet v 2 133 686 182.6 3.1e-48
O65810 Gly m 3 131 684 182.1 4.3e-48
QID21357 Pop n 2.0101 131 684 182.1 4.3e-48
Q9XF40 Mal d 4 131 683 181.8 5.2e-48
O65812 Hev b 8.0101 131 683 181.8 5.2e-48
P84177 Cit s 2.0101 131 683 181.8 5.2e-48
Q9XF41 Mal d 4 131 682 181.6 6.2e-48
Q9AXH4 Cor a 2 131 682 181.6 6.2e-48
Q9T0M8 Par j 3 131 682 181.6 6.2e-48
CAD10376 Cap a 2 131 681 181.3 7.4e-48
AF377948 Mus a 1.0101 131 677 180.3 1.5e-47
Q5EF31 Cro s 1.0101 131 670 178.5 5.2e-47
Q42449 Ara t 8 131 668 178.0 7.5e-47
AAK01235 Cor a 2 131 666 177.5 1.1e-46
Q9SQI9 Ara h 5 131 661 176.2 2.6e-46
FG438715 Act d 9.0101 109 557 149.6 2.2e-38
QEQ43417 Sola m 1.0101 159 479 129.4 3.8e-32
A0A1B2YLJ4 Tyr p 36.0101 131 254 71.8 7e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 239.3 bits 907,  Expect = 3e-65
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 2. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 216.7 bits 819,  Expect = 2e-58
 Identities = 115/133 86%, Positives = 126/133 94%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDIEGTGQHLT+AAILGLDGTVWA+S KFP+FKPEEMKGII EF+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ GAKYMVLQGE GAVIRGKKGAGGICIKKTGQAM+MGIYDEPVAPGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 3. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 210.8 bits 796,  Expect = 1e-56
 Identities = 112/133 84%, Positives = 123/133 92%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDIEGTGQHLTSAAI+G DGTVWA+SA FP+FKP E+  IIKEF+EAG
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ GAKYMV+QGE GAVIRGKKGAGGICIKKTGQAM+ GIYDEPVAPGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYLL+QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 4. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 205.2 bits 774,  Expect = 5e-55
 Identities = 105/132 79%, Positives = 121/132 91%, Gaps = 0/132 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+IEGT  HLT AAILGLDG+VWAQSA FPQFKP+E+  I+++FDE G
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGEPGAVIRGKKGAGGIC+KKTGQA++MGIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLLEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 5. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 203.9 bits 769,  Expect = 1e-54
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HL SAAILG DGTVWAQSA FPQFKPEE+ GI+K+FDE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTGMF+AGAKYMV+QGEPGAVIRGKKGAGGI IKKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 6. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 202.1 bits 762,  Expect = 4e-54
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HL SAAILG DGTVWAQSA FPQFKPEE+ GI+K+FDE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTGMF+AGAKYMV+QGEPG VIRGKKGAGGI IKKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 7. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 202.1 bits 762,  Expect = 4e-54
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HL SAAILG DGTVWAQSA FPQFKPEE+ GI+K+FDE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTGMF+AGAKYMV+QGEPG VIRGKKGAGGI IKKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 8. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 201.8 bits 761,  Expect = 5e-54
 Identities = 103/133 77%, Positives = 119/133 89%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMC+IEGT  HLT+AAILG+DG+VWAQSA FPQFKP+E+  ++KEFDEAG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGE G VIRGKKG GGIC+KKTGQA+I GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 9. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 201.1 bits 758,  Expect = 9e-54
 Identities = 104/133 78%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDIEGT  HLT AAILG+DG+VWAQSA FPQFKP+E+  I+KEFDE G
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGE G VIRGKKG GGIC+KKTGQA+I GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 10. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 199.5 bits 752,  Expect = 2e-53
 Identities = 100/133 75%, Positives = 119/133 89%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMC+IEGT  HL++AAILG+DG+VWAQSA FPQFKP+E+  ++K+FD  G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGEPG VIRGKKG GGIC+KKTGQA+I+GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 11. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 199.0 bits 750,  Expect = 3e-53
 Identities = 107/131 81%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HL SAAI+G DGTVWAQSA FPQFKPEE+ GI+K++DE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTGMF+A AKYMV+QGEPGAVIRGKKGAGGI IKKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 12. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 197.2 bits 743,  Expect = 1e-52
 Identities = 101/133 75%, Positives = 120/133 90%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDI+G GQHL +A+I+G DG++WAQSA FPQ+KPEE+ GI+K+FDE G
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG++IAG KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 13. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 196.7 bits 741,  Expect = 2e-52
 Identities = 102/133 76%, Positives = 119/133 89%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVDEHLMC+IE TG HLTS+AI+G+DG++WAQS+ FPQ KP+E++ I KEFD   
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGEPGAVIRGKKG GG+CIKKT QA+I GIYDEPVAPGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 14. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 194.9 bits 734,  Expect = 6e-52
 Identities = 97/133 72%, Positives = 115/133 86%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            M WQ YVD+HLMC+IEGT  HL+ AAILG+DG+VWAQSA FPQFKP+E+  ++K+FD  G
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGEPG  IRGKKG GGIC+KKTGQA++ GIYDEPV PGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 15. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 194.7 bits 733,  Expect = 7e-52
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMCDI+  G+HLT+AAI+G DG+VWAQS+ FPQFKPEE+  I+K+FDE G
Sbjct  1    MSWQTYVDEHLMCDID--GHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+I+GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 16. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 194.4 bits 732,  Expect = 9e-52
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HLTSAAI+G DGTVWAQSA FPQFKPEEM  I+K+FDE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+   KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 17. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 192.9 bits 726,  Expect = 2e-51
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+IE  G+HLTSAAI+G DGTVWAQSA FP FKPEEM  I+K+FDE G
Sbjct  1    MSWQAYVDDHLMCEIE--GHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+   KYMV+QGEPGAVIRGKKG+GG+ +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            +E+LGDYL+EQGM
Sbjct  119  IEKLGDYLIEQGM 131

Sequence Alignment: 18. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 192.1 bits 723,  Expect = 4e-51
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVDEHLMC+IE  GQHL++AAI+G DG+VWAQS  FP++KPEE+ GIIK+FDE G
Sbjct  1    MSWQAYVDEHLMCEIE--GQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG ++I+G+YDEP+ PGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 19. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 191.1 bits 719,  Expect = 9e-51
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HL+CDIE  GQHL++AAI+G DG+VWAQS  FP++KPEE+ G+IK+FDE G
Sbjct  1    MSWQAYVDDHLLCDIE--GQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG ++I+GIYDEP+ PGQCNMV
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 20. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 191.1 bits 719,  Expect = 9e-51
 Identities = 102/133 76%, Positives = 118/133 88%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCDIEG-TGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
            MSWQAYVD+HLMCDIEG  G+ LT+AAI+G DG+VWAQSA FPQFKPEEM GI+ +F+E 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
            G LAPTG+ + G KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLLEQGM 133
            VVERLGDYLLEQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 21. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 190.6 bits 717,  Expect = 1e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+I+  GQHLT+AAI+G DG+VWAQS+ FPQFKPEE+  I+K+FDE G
Sbjct  1    MSWQTYVDEHLMCEID--GQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGE GAVIRGKKGAGGI +KKTGQA+I GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 22. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 190.6 bits 717,  Expect = 1e-50
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HL+SAAI+G DG VWAQS  FPQFKPEEM  IIK+FDE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAP G+F+   KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 23. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 190.3 bits 716,  Expect = 1e-50
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IE  G+HLTSAAI+G DG  WAQS  FP+FKPEEM  I+K+FDE G
Sbjct  1    MSWQTYVDEHLMCEIE--GHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+ + G KYMV+QGEPGAVIRGKKG+GGI +KKTGQ++I+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 24. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 190.3 bits 716,  Expect = 2e-50
 Identities = 96/133 72%, Positives = 120/133 90%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCDIEGT-GQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
            MSWQAYVD+HLMC++EG  GQ LT+AAI+G DG+VWAQS+ FPQ KPEE+ GI+K+FDE 
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
            G LAPTG+++ GAKYMV+QGEP AVIRGKKG+GG+ IKKTGQA++ G+YDEPV PGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  VVERLGDYLLEQGM 133
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 25. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 190.3 bits 716,  Expect = 2e-50
 Identities = 102/133 76%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQH-LTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
            MSWQAYVD+HLMCDIEG   H LT+AAI+G DG+VWAQSA FPQFKPEEM GI+ +F+E 
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
            G LAPTG+ + G KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLLEQGM 133
            VVERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 26. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 189.8 bits 714,  Expect = 2e-50
 Identities = 101/133 75%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCDIEG-TGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
            MSWQAYVD+HLMCDIEG  G+ LT+AAI+G DG+VWAQSA FPQFKPEEM GI+ +F+E 
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
            G LAPTG+ + G KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLLEQGM 133
            V ERLGDYLLEQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 27. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 189.0 bits 711,  Expect = 4e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP FKPEE+  I+K+FD+ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGEPGAVIRGKKG+GGI IKKT QA+++GIYDEPV PGQCN+V
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 28. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 188.8 bits 710,  Expect = 4e-50
 Identities = 96/133 72%, Positives = 118/133 88%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMCDI+G GQHLT+AAI+G DG++WAQS+ FPQ+K +E+  I K+F+E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+ ++G KYMV+QGEPGAVIRGKKG+GG+ IKKTGQA+I GIY+EPV PGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 29. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 188.0 bits 707,  Expect = 7e-50
 Identities = 98/130 75%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSW+AYVD+HL C+I+  GQHLTSAAILG DG+VWAQS  FPQFKPEE+ GI+K+F+E G
Sbjct  1    MSWKAYVDDHLCCEID--GQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG A+I+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 30. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 187.5 bits 705,  Expect = 1e-49
 Identities = 93/133 69%, Positives = 119/133 89%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCDIEGT-GQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
            MSWQ YVD+HLMC+++G  GQ+L++AAI+G DG+VWAQS+ FP+FKPEE+ GI+K FDE 
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
            G LAPTG+++ G KYMV+QGEP AVIRGKKG+GG+ IKKTGQA++ G+YDEPV PGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  VVERLGDYLLEQGM 133
            +VERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 31. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 187.2 bits 704,  Expect = 1e-49
 Identities = 98/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDIEG   HLTSAAI+G DG+VWAQSA FPQFKPEE+  I+ +F E G
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGE GAVIRGKKGAGGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDY++EQG+
Sbjct  119  VERLGDYIIEQGL 131

Sequence Alignment: 32. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 187.0 bits 703,  Expect = 1e-49
 Identities = 95/131 72%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+IEG   HLTSAAI+G DG+VWA+S  FPQ+KPEE+ GI+ +F+E G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG++I G+KYMV+QGEPGAVIRGKKG GG+ +KKT  A+++GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 187.0 bits 703,  Expect = 1e-49
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMC+IEG   HLTSAAI+G DG+VWAQS  FPQ+KPEE+ GI+ +F + G
Sbjct  1    MSWQVYVDEHLMCEIEGN--HLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG++I G KYMV+QGEPGAVIRGKKG GG+ +KKTG A+++GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 34. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 187.0 bits 703,  Expect = 1e-49
 Identities = 99/130 76%, Positives = 112/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HL C+I+  GQHLTSAAILG DG VW QS  FPQFKPEE+ GIIK+FDE G
Sbjct  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG  +I+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 35. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 186.7 bits 702,  Expect = 2e-49
 Identities = 96/130 73%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+IEG   HL++AAI+G DG+VWAQSA FPQFK EE+ GI+ +F E G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG++I G KYMV+QGEPGAVIRGKKG GG+ +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 36. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 186.7 bits 702,  Expect = 2e-49
 Identities = 97/130 74%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HL C+I+  GQHLTSAAILG DG+VWA+S  FP+FKPEE+ GI+K+F+E G
Sbjct  1    MSWQAYVDDHLCCEID--GQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG A+I+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 37. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 186.5 bits 701,  Expect = 2e-49
 Identities = 98/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVDEHLMC+IE  G+HL +AAI+G DG  WAQS  FP+FK E+M  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCEIE--GHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+   KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 38. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 186.5 bits 701,  Expect = 2e-49
 Identities = 97/131 74%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP FKPEE+  I+K+FD+ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGE GAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 39. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 186.5 bits 701,  Expect = 2e-49
 Identities = 96/131 73%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDI+  G+ LT+AAI+G DG+VWAQS+ FPQFK +E+  ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+I+GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 40. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 186.2 bits 700,  Expect = 3e-49
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCD+EG    LT+AAILG DG+VWAQSA FPQ+KPEE+KGI  +F E G
Sbjct  1    MSWQTYVDDHLMCDVEGN--RLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+FI G KYMV+QGEP AVIRGKKGAGG+ IKKT QA + GIY+EP+ PGQCNMV
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 186.2 bits 700,  Expect = 3e-49
 Identities = 95/133 71%, Positives = 115/133 86%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMCDI+G GQHL +AAI+G DG+VWAQS+ FPQFK EE+  I+K+F+E G
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+ + G KYMV+QGE GAVIRGKKG+GG+ IKKT QA++ GIY+EPV PGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 42. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 185.7 bits 698,  Expect = 4e-49
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMC+ +  GQHLT+AAI+G DG+VWAQSA FPQFKP E+  I+K+FDE G
Sbjct  1    MSWQTYVDDHLMCETD--GQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGEPGAVIRGKKG GGI +KKT QA+I+GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLVDQGL 131

Sequence Alignment: 43. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 184.9 bits 695,  Expect = 6e-49
 Identities = 94/131 71%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDI+  G+ LT+AAI+G DG+VWAQS+ FPQFK +E+  ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+I+GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLL+QG+
Sbjct  119  VERLGDYLLDQGL 131

Sequence Alignment: 44. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 184.9 bits 695,  Expect = 6e-49
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP FKPEE+  I+K+FD+ G
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGE GAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 45. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 184.9 bits 695,  Expect = 6e-49
 Identities = 96/131 73%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP FKPEE+  I+K+FD+ G
Sbjct  1    MSWQQYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGE GAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 184.7 bits 694,  Expect = 7e-49
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP FKPEE+  I+K++D+ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGE GAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 47. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 184.6 bits 694,  Expect = 8e-49
 Identities = 97/130 74%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSW+AYVD+HL C+I+  GQ+LTSAAILG DG+VWAQS  FPQFKPEE  GI+K+F+E G
Sbjct  1    MSWKAYVDDHLCCEID--GQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG A+I+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 48. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 184.4 bits 693,  Expect = 9e-49
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDIEG   HL+SAAILG DGTVWAQS  FPQ+KPEE+  I+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGN--HLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGEPG VIRGKKG GG+ IKKT QA+I+GIY EP+ PGQCNMV
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VER+GDYL+EQGM
Sbjct  119  VERIGDYLVEQGM 131

Sequence Alignment: 49. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 184.4 bits 693,  Expect = 9e-49
 Identities = 96/132 72%, Positives = 116/132 87%, Gaps = 1/132 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCD+ G G    SAAI+G DG+VWAQSA FPQ+KPEE+ GI+ +F+EAG
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGE GAVIRGKKG+GG  +KKTGQA+++GIYDEP+ PGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQG+
Sbjct  120  VERLGDYLLEQGL 132

Sequence Alignment: 50. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 184.1 bits 692,  Expect = 1e-48
 Identities = 95/130 73%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HL C+I+  GQHLTSAAILG DG+VW +S  FP+FKPEE+ GI+K+F+E G
Sbjct  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG A+I+GIYDEP+ PGQCN+V
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 51. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 183.9 bits 691,  Expect = 1e-48
 Identities = 95/131 72%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVDEHLMC+I+  G+HLT+AAILG DG+VWAQS+ FPQFK EE+  I+ +F+E G
Sbjct  1    MSWQAYVDEHLMCEID--GHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++   KYMV+QGEPGAVIRGKKG+GG+ +KKT QA+I GIY+EP+ PGQCNMV
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLIEQGM 131

Sequence Alignment: 52. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 183.9 bits 691,  Expect = 1e-48
 Identities = 94/130 72%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HL+CDIEG   HLT AAI+G DG+VWAQS  FPQFKPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLLCDIEGN--HLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG GG+ +KKTG A+I+GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQG 132
            VER GDYL++QG
Sbjct  119  VERPGDYLIDQG 130

Sequence Alignment: 53. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 183.9 bits 691,  Expect = 1e-48
 Identities = 93/131 70%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCDI+  G+HLT+AAILG DG+VWAQS+ FP+FKPEE+  I+K+FDE G
Sbjct  1    MSWQAYVDDHLMCDID--GHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGE GAVIRGKKG+GG+ +KKT QA++ GIY+EP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 54. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 183.6 bits 690,  Expect = 1e-48
 Identities = 95/130 73%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+I+  GQHL+SAAILG D TVWAQS  FPQFKPEE+  I+ +F+  G
Sbjct  1    MSWQAYVDDHLMCEID--GQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPG VIRGKKG GGI +KKT  A+I+G+YDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYLLEQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 55. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 183.4 bits 689,  Expect = 2e-48
 Identities = 92/131 70%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+IEG   HL++AAI+G DG+VWAQSA FPQ+KPEE+ GI+ +F+E G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG GG+ +KK+  A+++GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 56. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 183.1 bits 688,  Expect = 2e-48
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDI+  G+ LT+AAI+G DG+VWAQS+ FPQFK +E+  I+K+FDE G
Sbjct  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ +   KYMV+QGEPGAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 57. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 183.1 bits 688,  Expect = 2e-48
 Identities = 98/133 73%, Positives = 115/133 86%, Gaps = 1/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQH-LTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEA 59
            MSWQAYVD+HLMCDIEG   H LT+AAI+G DG+VWAQSA FPQFKPEE+ GI+ +F+E 
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   GTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNM 119
            GTLAPTG+ + G KYMV+QGE GAVIRGKKG+GGI IKKT QA++ GIY+EPV PGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  VVERLGDYLLEQGM 133
            VV RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 58. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 182.9 bits 687,  Expect = 3e-48
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHL+C+ EG   HLTSAAI+G DGTVWAQSA FPQFKPEE+ GI+ +F   G
Sbjct  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+++ G KYMV+QGEP AVIRGKKG GGI IKKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 59. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 182.9 bits 687,  Expect = 3e-48
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHL+C+ EG   HLTSAAI+G DGTVWAQSA FPQFKPEE+ GI+ +F   G
Sbjct  1    MSWQTYVDEHLLCENEGN--HLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+++ G KYMV+QGEP AVIRGKKG GGI IKKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 60. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 182.6 bits 686,  Expect = 3e-48
 Identities = 93/133 69%, Positives = 115/133 86%, Gaps = 0/133 0%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMCDI+G   +  ++AI+G DG+VWAQS+ FPQFKP+E+ GI+K+F+E G
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+ + G KYMV+QGE GAVIRGKKG+GGI IKKTGQA++ GIY+EPV PGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 61. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 182.1 bits 684,  Expect = 4e-48
 Identities = 93/130 71%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HL+C IEG   HLT AAI+G DG+VW QS  FPQFKPEE+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLLCGIEGN--HLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG GG+ +KKTG A+I+GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 62. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 182.1 bits 684,  Expect = 4e-48
 Identities = 93/131 70%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMCDIEG    LTSAAI+G DG+VWA SA FPQF  EE+  I+K+F+E G
Sbjct  1    MSWQVYVDDHLMCDIEGN--TLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+F+ G KYMV+QGEPGAVIRGKKG+GG+ +KKT QA+I+G+YDEP+ PGQCNM+
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 63. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 181.8 bits 683,  Expect = 5e-48
 Identities = 92/131 70%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+ LMCDI+  G+HLT+AAILG DG+VWA+S+ FP+FKPEE+  I+K+FDE G
Sbjct  1    MSWQAYVDDRLMCDID--GHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+ + G KYMV+QGE GAVIRGKKG+GG+ +KKTGQA++ GIY+EP+ PGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 64. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 181.8 bits 683,  Expect = 5e-48
 Identities = 95/131 72%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDE LMC+IEG   HLT+AAI+G DG+VWAQS+ FPQFK EE+  I+ +FDE G
Sbjct  1    MSWQTYVDERLMCEIEGN--HLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+ + G KYMV+QGE GAVIRGKKG GG+ ++KT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 65. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 181.8 bits 683,  Expect = 5e-48
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCDI+G    LT+AAILG DG+VW+QSA FP F+ EE+  I+K+FD+ G
Sbjct  1    MSWQAYVDDHLMCDIDGN--RLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+F+ G KYMV+QGE GAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 66. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 181.6 bits 682,  Expect = 6e-48
 Identities = 91/131 69%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMC+IEG   HL++AAI+G +G+VWAQSA FPQ+KPEE+ GI+ +F+E G
Sbjct  1    MSWQAYVDDHLMCEIEGN--HLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPG VIRGKKG GG+ +KK+  A+++GIYDEP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 67. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 181.6 bits 682,  Expect = 6e-48
 Identities = 91/131 69%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAY DEHLMC+IEG    L +AAI+G DG+VWAQS+ FPQ+KPEE+ G++ +F+E G
Sbjct  1    MSWQAYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG GG+ +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 68. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 181.6 bits 682,  Expect = 6e-48
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HLMCD+ G G  L SAAI+G DG+VWAQSA FPQ+KPEE+ GI+ +F+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGE GAVI GKKG+GG  +KKTGQA+++GIYDEP+ PGQCN+V
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYLLEQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 69. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 181.3 bits 681,  Expect = 7e-48
 Identities = 95/131 72%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMC+IEG    LTSAAI+G DG+VWAQSA FPQFKPEE+  I+ +F E G
Sbjct  1    MSWQTYVDDHLMCEIEGN--RLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            TLAPTG+++ G KYMV+QGE GAVIRGKKG GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL+EQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 70. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 180.3 bits 677,  Expect = 2e-47
 Identities = 94/130 72%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQAYVD+HL+CDI+  GQ LT+AAI+G DG+VWAQS  FPQ KPEE+  I+K+FDE G
Sbjct  1    MSWQAYVDDHLLCDID--GQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGAVIRGKKG+GG+ IKKT  A+I+GIY+EP+ PGQCNMV
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLFDQG 130

Sequence Alignment: 71. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 178.5 bits 670,  Expect = 5e-47
 Identities = 93/130 71%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVDEHLMCD++  G+ LTSAAILG DG+VWAQSA FP++KP E+  I+ +F+E G
Sbjct  1    MSWQTYVDEHLMCDMD--GHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTGM+I GAKYMV+QGEPG VIRGKKG+GG+ IKK+  A+I G+YDEP+ PGQCN+V
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLLEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 72. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 178.0 bits 668,  Expect = 7e-47
 Identities = 93/128 72%, Positives = 112/128 87%, Gaps = 2/128 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ+YVD+HLMCD+EG   HLT+AAILG DG+VWAQSAKFPQ+KP+E+ GI K+F+E G
Sbjct  1    MSWQSYVDDHLMCDVEGN--HLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
             LAPTG+F+ G KYMV+QGE GAVIRGKKG GG+ IKKT QA++ G YDEP+  GQCN+V
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLLE 130
            VERLGDYL+E
Sbjct  119  VERLGDYLIE 128

Sequence Alignment: 73. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 177.5 bits 666,  Expect = 1e-46
 Identities = 89/131 67%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ Y DEHLMC+IEG    L +AAI+G DG+VWAQS+ FPQ+KPEE+ G++ +F+E G
Sbjct  1    MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGAVIR KKG GG+ +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 74. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 176.2 bits 661,  Expect = 3e-46
 Identities = 89/131 67%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD HL+C+IE  G HL+SAAILG DG VWAQS+ FPQFKPEE+  I+ +F E G
Sbjct  1    MSWQTYVDNHLLCEIE--GDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
            +LAPTG+++ G KYMV+QGEPGA+I GKKG GG+ I+KT QA+I+GIYD+P+ PGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLLEQGM 133
            VERLGDYL++ G+
Sbjct  119  VERLGDYLIDTGL 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 149.6 bits 557,  Expect = 2e-38
 Identities = 77/109 70%, Positives = 94/109 86%, Gaps = 2/109 1%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
            MSWQ YVD+HLMC+IEG   +LTSAAI+G DG++WAQSA FPQFKPEE+  I+ +F E G
Sbjct  1    MSWQTYVDDHLMCEIEGN--YLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEP 111
            TLAPTG+++ G KYMV+QGE GAVIRGKKG GG+ +KKT QA+I+GIYDEP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 129.4 bits 479,  Expect = 4e-32
 Identities = 97/130 74%, Positives = 116/130 89%, Gaps = 30/130 23%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQ----------------- 43
            MSWQ YVD+HLMCD+E  G+HL SAAILG+DG+VWAQS  FP+                 
Sbjct  1    MSWQTYVDDHLMCDLE--GHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------FKPEEMKGIIKEFDEAGTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAG 92
                       FKPEE+  I+K+FDE G LAPTG+F+ G KYMV+QGEPGAVIRGKKG+ 
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GICIKKTGQAMIMGIYDEPVAPGQCNMVVERLGDYLLEQG 132
            GI IKKTGQA+I GIY+EPV PGQCNMVVE++GDYL++QG
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 71.8 bits 254,  Expect = 7e-15
 Identities = 49/120 40%, Positives = 74/120 61%, Gaps = 14/120 11%
Query  1    MSWQAYVDEHLMCDIEGTGQHLTS--AAILGL-DGTVWAQSAK-FP-QFKPEEMKGIIKE 55
            MSWQ+YVD ++ C      QH+    A I GL DG VWA+  K +P Q   +E+K I   
Sbjct  1    MSWQSYVDNQI-C------QHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADA 53
Query  56   F-DEAGTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAP 114
                  ++   G+ + G KY+ +Q +  +++RG+KG+  +CI  T   ++     +   P
Sbjct  54   IRSNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPP 112
Query  115  GQCNMVVERLGDYL 128
            GQ N VVE+LGDYL
Sbjct  113  GQLNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.