The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLLEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
P35082 Zea m 12.0102 131 900 246.7 1.5e-67
Q9FUD1 Ory s 12.0101 131 831 228.3 5.1e-62
P35081 Zea m 12.0101 131 831 228.3 5.1e-62
O04725 Cyn d 12 131 831 228.3 5.1e-62
P35083 Zea m 12.0103 131 830 228.1 6.2e-62
Q9M7N0 Hev b 8.0201 131 796 219.0 3.3e-59
O24650 Phl p 12.0102 131 792 217.9 6.9e-59
Q8L5D8 Pho d 2.0101 131 785 216.1 2.5e-58
P35079 Phl p 12.0101 131 785 216.1 2.5e-58
CAA54686 Phl p 12.0101 131 785 216.1 2.5e-58
O24282 Phl p 12.0103 131 784 215.8 3e-58
Q9M7M8 Hev b 8.0203 131 779 214.5 7.6e-58
Q9M7M9 Hev b 8.0202 131 774 213.1 1.9e-57
Q9LEI8 Hev b 8.0204 131 772 212.6 2.8e-57
O22655 Zea m 12.0104 131 770 212.1 4e-57
A0A2I4DNN6 Jug r 7.0101 131 764 210.5 1.2e-56
Q9FR39 Zea m 12.0105 131 754 207.8 7.7e-56
AAL07320 Lit c 1 131 748 206.2 2.3e-55
Q9XF38 Pyr c 4 131 746 205.7 3.4e-55
Q9STB6 Hev b 8.0102 131 745 205.4 4.1e-55
Q9AXH4 Cor a 2 131 745 205.4 4.1e-55
O24169 Ole e 2 134 745 205.4 4.2e-55
O24170 Ole e 2 134 745 205.4 4.2e-55
FM164277 Tri a 12.0104 131 744 205.1 4.9e-55
P49233 Tri a 12.0102 141 743 204.8 6.7e-55
O65812 Hev b 8.0101 131 741 204.3 8.6e-55
P52184 Hor v 12.0101 131 740 204.1 1e-54
O24171 Ole e 2 134 740 204.1 1.1e-54
Q9XF40 Mal d 4 131 738 203.5 1.5e-54
QVU02258 Que ac 2.0101 133 738 203.5 1.5e-54
O49894 Mer a 1 133 737 203.3 1.8e-54
Q9XF37 Api g 4 134 737 203.3 1.9e-54
CAD37202 Pru p 4.0201 131 736 203.0 2.2e-54
AAL76933 Dau c 4 134 735 202.7 2.7e-54
AF377948 Mus a 1.0101 131 734 202.5 3.1e-54
Q9XF42 Mal d 4 131 733 202.2 3.8e-54
Q9XF41 Mal d 4 131 733 202.2 3.8e-54
P49232 Tri a 12.0101 138 733 202.2 4.1e-54
QID21357 Pop n 2.0101 131 731 201.7 5.4e-54
CAD37201 Pru p 4.0101 131 731 201.7 5.4e-54
P49234 Tri a 12.0103 140 731 201.6 6e-54
AAK01235 Cor a 2 131 729 201.1 7.9e-54
O65809 Gly m 3 131 728 200.9 9.5e-54
AAL92870 Che a 2 131 726 200.3 1.4e-53
AY081850 Pru du 4.0101 131 725 200.1 1.6e-53
O65810 Gly m 3 131 725 200.1 1.6e-53
AY081852 Pru du 4.0102 131 725 200.1 1.6e-53
AAK54835 Ana c 1 131 724 199.8 2e-53
AAP13533 Cuc m 2 131 724 199.8 2e-53
Q9XF39 Pru av 4 131 724 199.8 2e-53
XP030492464 Can s 2.0101 133 724 199.8 2e-53
P84177 Cit s 2.0101 131 722 199.3 2.9e-53
AAL29690 Lyc e 1 131 720 198.7 4.1e-53
Q5XWE1 Citr l 2.0101 131 719 198.5 5e-53
ACP43298 Ama r 2.0101 133 717 197.9 7.4e-53
CAD10376 Cap a 2 131 713 196.9 1.5e-52
A0A023W2L7 Pro j 2.0101 133 711 196.3 2.2e-52
P25816 Bet v 2 133 709 195.8 3.2e-52
Q93YG7 Sola l 1.0101 131 704 194.5 8e-52
CAD10377 Lyc e 1 131 704 194.5 8e-52
O81982 Hel a 2 133 701 193.7 1.4e-51
Q9XG85 Par j 3 132 700 193.4 1.7e-51
QRN65366 Lig v 2.0101 134 698 192.9 2.5e-51
Q9SQI9 Ara h 5 131 697 192.6 2.9e-51
Q9T0M8 Par j 3 131 693 191.5 6.1e-51
A0A0A0RCW1 Aca f 2 133 693 191.5 6.2e-51
A0A0A0REA1 Koc s 2.0101 133 691 191.0 9e-51
ABU95412 Sin a 4.0101 131 689 190.5 1.3e-50
Q5EF31 Cro s 1.0101 131 684 189.1 3.2e-50
ACS34771 Sal k 4.0101 133 684 189.1 3.3e-50
AJ421030 Art v 4.0101 133 676 187.0 1.4e-49
Q42449 Ara t 8 131 671 185.7 3.6e-49
AJ421031 Art v 4.0201 133 666 184.3 9.2e-49
ADK22841 Sal k 4.0201 133 666 184.3 9.2e-49
FG438715 Act d 9.0101 109 578 161.0 7.7e-42
QEQ43417 Sola m 1.0101 159 515 143.9 1.6e-36
A0A1B2YLJ4 Tyr p 36.0101 131 244 71.8 6.6e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 246.7 bits 900,  Expect = 1e-67
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 2. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 228.3 bits 831,  Expect = 5e-62
 Identities = 118/131 90%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHL +AAIVGHDG  WAQS AFP+FK E+M NIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 3. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 228.3 bits 831,  Expect = 5e-62
 Identities = 118/131 90%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHL +AAIVGHDGA WAQSTAFPEFK E+MA IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 4. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 228.3 bits 831,  Expect = 5e-62
 Identities = 115/131 87%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMCEIEGHHL +AAI+GHDG  WAQS AFP FK E+MANIMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLGPTKYMVIQGEPGAVIRGKKGSGG+TVKKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLLEQGM 131
            +LGDYL+EQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 5. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 228.1 bits 830,  Expect = 6e-62
 Identities = 117/131 89%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHL++AAIVGHDGA WAQSTAFP+FK E+M NI+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            AP GLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 219.0 bits 796,  Expect = 3e-59
 Identities = 110/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMC+I+GHHL AAAI+GHDG+ WAQS++FP+FK E++A IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 7. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 217.9 bits 792,  Expect = 7e-59
 Identities = 110/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHLA+AAI+GHDG  WAQS  FP+FK E++  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 8. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 216.1 bits 785,  Expect = 3e-58
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVDEHLMCEI+GHHL AAAI+GHDG+ WAQS++FP+FK+E++ NIM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 9. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 216.1 bits 785,  Expect = 3e-58
 Identities = 109/131 83%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHLA+AAI+GHDG  WAQS  FP+FK E++  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPG VIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 10. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 216.1 bits 785,  Expect = 3e-58
 Identities = 109/131 83%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHLA+AAI+GHDG  WAQS  FP+FK E++  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPG VIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 11. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 215.8 bits 784,  Expect = 3e-58
 Identities = 109/131 83%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHLA+AAI GHDG  WAQS  FP+FK E++  IMKD+DEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 12. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 214.5 bits 779,  Expect = 8e-58
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+GH L AAAI+GHDG+ WAQS+ FP+FK++++A +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 213.1 bits 774,  Expect = 2e-57
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+GH L AAAI+GHDG+ WAQS++FP+FK++++A IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 14. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 212.6 bits 772,  Expect = 3e-57
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+GH L AAAI+GHDG+ WAQS++FP+FK++++A +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLL+QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 15. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 212.1 bits 770,  Expect = 4e-57
 Identities = 106/130 81%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVDEHLMCEIEG+HL+AAAIVGHDG+ WAQS +FPE+K E++A I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 16. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 210.5 bits 764,  Expect = 1e-56
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEI+G+HL AAAI+GHDG+ WAQS++FP+FK E++A IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKG+GGITVKKTGQAL+ GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 17. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 207.8 bits 754,  Expect = 8e-56
 Identities = 103/130 79%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HL+C+IEG+HL+AAAIVGHDG+ WAQS  FPE+K E++A ++KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 18. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 206.2 bits 748,  Expect = 2e-55
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMCE +G+HL AAAI+GHDG+ WAQS  FP+FK  ++A IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 19. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 205.7 bits 746,  Expect = 3e-55
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMC+I+GHHL AAAI+GHDG+ WAQS+ FP+FK E++  IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGG+TVKKT QALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 20. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMCEIEG+HL+AAAI+G+DG+ WAQS  FP+FK+E++  IM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 21. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAY DEHLMCEIEG+ LAAAAI+GHDG+ WAQS+ FP++K E++  +M DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 22. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 108/131 82%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGHH---LAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
            MSWQAYVD+HLMC+IEGH    L AAAIVGHDG+ WAQS  FP+FK E+M  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VVERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 23. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 205.4 bits 745,  Expect = 4e-55
 Identities = 108/131 82%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGHH---LAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
            MSWQAYVD+HLMC+IEGH    L AAAIVGHDG+ WAQS  FP+FK E+M  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VVERLGDYLLEQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 24. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 205.1 bits 744,  Expect = 5e-55
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSW+AYVD+HL CEI+G+HL +AAI+GHDG+ WAQS  FP+FK E++A I+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 25. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 204.8 bits 743,  Expect = 7e-55
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HL CEI+G+HL +AAI+GHDG+ WA+S  FP+FK E++A I+KDF+EPGHL
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 26. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 204.3 bits 741,  Expect = 9e-55
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDE LMCEIEG+HL AAAI+G+DG+ WAQS+ FP+FK+E++  IM DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKG GG+TV+KT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 27. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 204.1 bits 740,  Expect = 1e-54
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HL CEI+G+HL +AAI+GHDG  W QS  FP+FK E++A I+KDFDEPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 28. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 204.1 bits 740,  Expect = 1e-54
 Identities = 107/131 81%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGHH---LAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
            MSWQAYVD+HLMC+IEGH    L AAAIVGHDG+ WAQS  FP+FK E+M  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            V ERLGDYLLEQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 29. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 203.5 bits 738,  Expect = 1e-54
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+ LMC+I+GHHL AAAI+GHDG+ WA+S+ FP+FK E++  IMKDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGG+TVKKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 30. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 203.5 bits 738,  Expect = 2e-54
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGH--HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVDEHLMC+I+G+  HLAAAAI+GHDG+ WAQS+ FP+FK E++++IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTGL LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 31. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 203.3 bits 737,  Expect = 2e-54
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGH--HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVD+HLMC+I+G+  HLAAA+IVGHDG+ WAQS +FP++K E++  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTGL++  TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 32. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 203.3 bits 737,  Expect = 2e-54
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGHH---LAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
            MSWQAYVD+HLMCE+EG+    L AAAI+GHDG+ WAQS+ FP+ K E++A IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTGL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLLEQGM 131
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 33. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 203.0 bits 736,  Expect = 2e-54
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMCEIEG+HL+AAAI+GHDG+ WAQS  FP++K E++  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKK+  AL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 34. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 202.7 bits 735,  Expect = 3e-54
 Identities = 100/131 76%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGH---HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
            MSWQ YVD+HLMCE++G+   +L+AAAI+GHDG+ WAQS+ FP+FK E++  IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTGL+LG TKYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLLEQGM 131
            +VERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 35. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 202.5 bits 734,  Expect = 3e-54
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HL+C+I+G+ L AAAIVGHDG+ WAQS AFP+ K E++A IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 36. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 202.2 bits 733,  Expect = 4e-54
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMC+I+G+ L AAAI+G+DG+ W+QS +FP FK E++A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 202.2 bits 733,  Expect = 4e-54
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMCEIEG+HL+AAAI+GH+G+ WAQS  FP++K E++  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GG+TVKK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 202.2 bits 733,  Expect = 4e-54
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HL CEI+G+HL +AAI+GHDG+ W +S  FP+FK E++A I+KDF+EPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 201.7 bits 731,  Expect = 5e-54
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+IEG+ L +AAI+GHDG+ WA S +FP+F  E+++ IMKDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL++G+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 40. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 201.7 bits 731,  Expect = 5e-54
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMC+I+G+ L AAAI+G+DG+ W+QS  FP FK E++A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 201.6 bits 731,  Expect = 6e-54
 Identities = 100/130 76%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSW+AYVD+HL CEI+G++L +AAI+GHDG+ WAQS  FP+FK E+ A I+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 42. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 201.1 bits 729,  Expect = 8e-54
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ Y DEHLMCEIEG+ LAAAAI+GHDG+ WAQS+ FP++K E++  +M DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIR KKG GG+TVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 43. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 200.9 bits 728,  Expect = 9e-54
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HL+C+IEG+HL  AAI+G+DG+ WAQST FP+FK E++  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 44. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 200.3 bits 726,  Expect = 1e-53
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+IEG+HL++AAI+GHDG  WAQS +FP++K E+++ IMKDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG GG+T+KKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            R+GDYL+EQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 45. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 200.1 bits 725,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L AAAI+G+DG+ W+QS  FP FK E++A I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 200.1 bits 725,  Expect = 2e-53
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HL+C IEG+HL  AAI+G+DG+ W QST FP+FK E++  IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 47. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 200.1 bits 725,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L AAAI+G+DG+ W+QS  FP FK E++A I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 48. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 199.8 bits 724,  Expect = 2e-53
 Identities = 99/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMCEI+G+HL++AAI+GHD   WAQS  FP+FK E+++ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 49. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 199.8 bits 724,  Expect = 2e-53
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEG+HL +AAI+G+DG+ WAQS  FP++K E++A I+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 199.8 bits 724,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMC+I+G+ L AAAI+G+DG+ W+QS  FP FK E++A I+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 51. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 199.8 bits 724,  Expect = 2e-53
 Identities = 99/131 75%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGH--HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVDEHLMC+I+G+  HL AAAI+GHDG+ WAQS++FP++K +++ +I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTGL L  TKYMVIQGEPGAVIRGKKGSGG+T+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 52. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 199.3 bits 722,  Expect = 3e-53
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMC+I+G+ L AAAI+G+DG+ W+QS  FP F+ E++A I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG TKYMVIQGE GAVIRGKKGSGGI VKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 198.7 bits 720,  Expect = 4e-53
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC+IEG+HL +AAI+G+DG+ WAQS  FP+FK E++  IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL LG TKYMVIQGE GAVIRGKKG+GGITVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 54. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 198.5 bits 719,  Expect = 5e-53
 Identities = 97/131 74%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQAYVD+HLMCEIEG+HL +AAI+G+DG+ WA+S  FP++K E++  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL++G +KYMVIQGEPGAVIRGKKG GG+TVKKT  ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 55. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 197.9 bits 717,  Expect = 7e-53
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQAYVD+HLMCEIEG  +HL  AAI+G DG+ WAQS  FP+FK +++A I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPGAVIRGKKG+GGI VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 56. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 196.9 bits 713,  Expect = 2e-52
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+ L +AAI+G+DG+ WAQS  FP+FK E++  IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGITVKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 57. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 196.3 bits 711,  Expect = 2e-52
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVD+HLMCEIEG  +HL+AAAI+G DG+ WAQS +FP+FK ++++ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPG VIRGKKG GGI VKKTGQAL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 58. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 195.8 bits 709,  Expect = 3e-52
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGH--HLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVDEHLMC+I+G+  +  A+AIVGHDG+ WAQS++FP+FK +++  IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTGL LG  KYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 59. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 194.5 bits 704,  Expect = 8e-52
 Identities = 97/131 74%, Positives = 112/131 85%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHL+CE EG+HL +AAI+G+DG  WAQS  FP+FK E++  IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 60. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 194.5 bits 704,  Expect = 8e-52
 Identities = 97/131 74%, Positives = 112/131 85%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHL+CE EG+HL +AAI+G+DG  WAQS  FP+FK E++  IM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 61. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 193.7 bits 701,  Expect = 1e-51
 Identities = 98/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQAYVDEHLMC+IEG  +HL +AAI+G DG  WAQS  FP+FK E+M  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+F+   KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLLEQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 62. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 193.4 bits 700,  Expect = 2e-51
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 1/131 0%
Query  1    MSWQAYVDEHLMCEI-EGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGH 59
            MSWQAYVD+HLMC++ +G+  A+AAI+GHDG+ WAQS  FP++K E++  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
            LAPTGLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 63. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 192.9 bits 698,  Expect = 3e-51
 Identities = 102/131 77%, Positives = 114/131 87%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGHH---LAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEP 57
            MSWQAYVD+HLMC+IEGH    L AAAIVGHDG+ WAQS  FP+FK E++  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTGL LG TKYMVIQGE GAVIRGKKGSGGIT+KKT QALV GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLLEQGM 131
            VV RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 64. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 192.6 bits 697,  Expect = 3e-51
 Identities = 93/131 70%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD HL+CEIEG HL++AAI+G+DG  WAQS+ FP+FK E++  IM DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GG+T++KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 65. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 191.5 bits 693,  Expect = 6e-51
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEI-EGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGH 59
            MSWQAYVD+HLMC++ +G+ LA+AAI+GHDG+ WAQS  FP++K E++  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVV 119
            LAPTGLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 66. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 191.5 bits 693,  Expect = 6e-51
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            M WQ YVD+HLMCEIEG  +HL+ AAI+G DG+ WAQS +FP+FK +++A ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGEPG  IRGKKG GGI VKKTGQALV GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 67. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 191.0 bits 691,  Expect = 9e-51
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVD+HLMC+IEG  +HL  AAI+G DG+ WAQS  FP+FK +++A I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 68. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 190.5 bits 689,  Expect = 1e-50
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMC++EG+ L AAAI+G+DG+ WAQS  FP++K E++  I  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEP AVIRGKKG+GG+T+KKT QA+V GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 69. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 189.1 bits 684,  Expect = 3e-50
 Identities = 90/130 69%, Positives = 111/130 85%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVDEHLMC+++GH L +AAI+GHDG+ WAQS  FPE+K  ++  I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGG+T+KK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 70. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 189.1 bits 684,  Expect = 3e-50
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVD+HLMCEIEG  +HL AAAI+G DG+ WAQS  FP+FK ++++ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 71. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 187.0 bits 676,  Expect = 1e-49
 Identities = 96/131 73%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVD+HLMC+IEG  +HL +AAI G DG  WA+S +FPEFK  ++  I+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
            +LAPTGLFLG  KYMVIQGE GAVIRGKKG+GGI +KKTGQA+V GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLL+QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 72. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 185.7 bits 671,  Expect = 4e-49
 Identities = 93/128 72%, Positives = 111/128 86%, Gaps = 0/128 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ+YVD+HLMC++EG+HL AAAI+G+DG+ WAQS  FP++K +++  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGLFLG  KYMVIQGE GAVIRGKKG GG+T+KKT QALV G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLLE 128
            RLGDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 184.3 bits 666,  Expect = 9e-49
 Identities = 94/131 71%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQ YVD+HLMC+IEG  +HL AAAI+G DG  WA+S  FPEFK E+M  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMV+QGE GAVIRGKKG+GGI +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 184.3 bits 666,  Expect = 9e-49
 Identities = 95/131 72%, Positives = 111/131 84%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIE--GHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
            MSWQAYVDEHLMC IE  G+HL ++AIVG DG+ WAQS+ FP+ K +++  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGLFLG  KYMVIQGEPGAVIRGKKG GG+ +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 161.0 bits 578,  Expect = 8e-42
 Identities = 80/109 73%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG++L +AAI+G+DG+ WAQS +FP+FK E++  IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEP 109
            APTGL+LG TKYMVIQGE GAVIRGKKG GG+TVKKT QAL++GIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 143.9 bits 515,  Expect = 2e-36
 Identities = 103/130 79%, Positives = 120/130 92%, Gaps = 28/130 21%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPE------------------- 41
            MSWQ YVD+HLMC++EGHHLA+AAI+G DG+ WAQS AFP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKTEDMANIMKDFDEPGHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGI 92
                     FK E++ NIMKDFDEPG LAPTGLFLG TKYMVIQGEPGAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLLEQG 130
            T+KKTGQAL+ GIY+EP+TPGQCNMVVE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 71.8 bits 244,  Expect = 7e-15
 Identities = 46/123 37%, Positives = 70/123 56%, Gaps = 6/123 4%
Query  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQ-STAFPEFKTEDMANIMKDF--DEP 57
            MSWQ+YVD ++ C+     LA  A + +DGA WA+    +P+  T+     + D     P
Sbjct  1    MSWQSYVDNQI-CQHVDCRLAVIAGL-QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNM 117
              +   G+ LG  KY+ IQ +  +++RG+KGS  + +  T   L+     +   PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  VVERLGDYL 126
            VVE+LGDYL
Sbjct  118  VVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.