The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL
APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE
RLGDYLIEQGF
Sequence Info Allergen Name Length Opt Bits Score E Value
O22655 Zea m 12.0104 131 889 253.1 1.8e-69
Q9FR39 Zea m 12.0105 131 869 247.6 8.4e-68
P52184 Hor v 12.0101 131 799 228.1 6e-62
FM164277 Tri a 12.0104 131 798 227.8 7.3e-62
P49233 Tri a 12.0102 141 797 227.5 1e-61
Q9XF41 Mal d 4 131 790 225.6 3.4e-61
AAP13533 Cuc m 2 131 789 225.3 4.1e-61
Q9M7N0 Hev b 8.0201 131 787 224.8 6.1e-61
P49232 Tri a 12.0101 138 787 224.7 6.6e-61
CAD37202 Pru p 4.0201 131 785 224.2 8.9e-61
P49234 Tri a 12.0103 140 782 223.3 1.8e-60
P35081 Zea m 12.0101 131 781 223.1 1.9e-60
A0A2I4DNN6 Jug r 7.0101 131 781 223.1 1.9e-60
Q5XWE1 Citr l 2.0101 131 780 222.8 2.3e-60
O24650 Phl p 12.0102 131 779 222.6 2.8e-60
AAK54835 Ana c 1 131 778 222.3 3.4e-60
Q9FUD1 Ory s 12.0101 131 777 222.0 4.2e-60
P35083 Zea m 12.0103 131 777 222.0 4.2e-60
P35079 Phl p 12.0101 131 776 221.7 5e-60
CAA54686 Phl p 12.0101 131 776 221.7 5e-60
O04725 Cyn d 12 131 774 221.2 7.4e-60
AF377948 Mus a 1.0101 131 774 221.2 7.4e-60
P35082 Zea m 12.0102 131 770 220.1 1.6e-59
Q9STB6 Hev b 8.0102 131 767 219.2 2.9e-59
Q9AXH4 Cor a 2 131 766 218.9 3.5e-59
AAL07320 Lit c 1 131 766 218.9 3.5e-59
O24282 Phl p 12.0103 131 762 217.8 7.5e-59
Q9LEI8 Hev b 8.0204 131 754 215.6 3.5e-58
AAL92870 Che a 2 131 753 215.3 4.2e-58
Q9XF42 Mal d 4 131 753 215.3 4.2e-58
Q9XF37 Api g 4 134 753 215.3 4.4e-58
Q9M7M8 Hev b 8.0203 131 752 215.0 5.1e-58
O49894 Mer a 1 133 752 215.0 5.3e-58
AAK01235 Cor a 2 131 750 214.5 7.5e-58
Q8L5D8 Pho d 2.0101 131 749 214.2 9.1e-58
CAD37201 Pru p 4.0101 131 747 213.7 1.3e-57
O65809 Gly m 3 131 747 213.7 1.3e-57
O65810 Gly m 3 131 744 212.8 2.4e-57
AAL76933 Dau c 4 134 744 212.8 2.5e-57
ACP43298 Ama r 2.0101 133 743 212.5 3e-57
Q9M7M9 Hev b 8.0202 131 742 212.3 3.5e-57
Q9XF38 Pyr c 4 131 742 212.3 3.5e-57
AY081852 Pru du 4.0102 131 741 212.0 4.3e-57
AY081850 Pru du 4.0101 131 741 212.0 4.3e-57
Q9XF39 Pru av 4 131 740 211.7 5.2e-57
A0A023W2L7 Pro j 2.0101 133 736 210.6 1.1e-56
Q5EF31 Cro s 1.0101 131 735 210.3 1.4e-56
AAL29690 Lyc e 1 131 734 210.0 1.6e-56
Q9XF40 Mal d 4 131 734 210.0 1.6e-56
QID21357 Pop n 2.0101 131 734 210.0 1.6e-56
ABU95412 Sin a 4.0101 131 731 209.2 2.9e-56
O65812 Hev b 8.0101 131 729 208.7 4.3e-56
CAD10376 Cap a 2 131 728 208.4 5.2e-56
CAD10377 Lyc e 1 131 726 207.8 7.7e-56
Q93YG7 Sola l 1.0101 131 726 207.8 7.7e-56
XP030492464 Can s 2.0101 133 726 207.8 7.9e-56
P84177 Cit s 2.0101 131 724 207.3 1.1e-55
O24169 Ole e 2 134 724 207.2 1.2e-55
O81982 Hel a 2 133 723 207.0 1.4e-55
O24170 Ole e 2 134 723 207.0 1.4e-55
O24171 Ole e 2 134 718 205.6 3.7e-55
A0A0A0RCW1 Aca f 2 133 717 205.3 4.4e-55
P25816 Bet v 2 133 714 204.5 7.9e-55
QVU02258 Que ac 2.0101 133 714 204.5 7.9e-55
Q9XG85 Par j 3 132 712 203.9 1.2e-54
A0A0A0REA1 Koc s 2.0101 133 712 203.9 1.2e-54
Q9SQI9 Ara h 5 131 707 202.5 3e-54
ACS34771 Sal k 4.0101 133 705 202.0 4.5e-54
QRN65366 Lig v 2.0101 134 704 201.7 5.5e-54
Q42449 Ara t 8 131 701 200.9 9.5e-54
Q9T0M8 Par j 3 131 700 200.6 1.1e-53
ADK22841 Sal k 4.0201 133 694 198.9 3.7e-53
AJ421031 Art v 4.0201 133 690 197.8 8.1e-53
AJ421030 Art v 4.0101 133 685 196.4 2.1e-52
FG438715 Act d 9.0101 109 594 171.3 6.3e-45
QEQ43417 Sola m 1.0101 159 508 147.1 1.8e-37
A0A1B2YLJ4 Tyr p 36.0101 131 257 77.5 1.3e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 253.1 bits 889,  Expect = 2e-69
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 2. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 247.6 bits 869,  Expect = 8e-68
 Identities = 125/131 95%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HL+C+IEGQHLSAAAIVGHDGSVWAQSE+FPELKPEEVAG+IKDFDEPGTL
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 3. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 228.1 bits 799,  Expect = 6e-62
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HL CEI+GQHL++AAI+GHDG VW QS +FP++KPEE+AGIIKDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 4. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 227.8 bits 798,  Expect = 7e-62
 Identities = 109/131 83%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSW+AYVD+HL CEI+GQHL++AAI+GHDGSVWAQS +FP++KPEE+AGI+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM+LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 5. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 227.5 bits 797,  Expect = 1e-61
 Identities = 109/131 83%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HL CEI+GQHL++AAI+GHDGSVWA+S +FP++KPEE+AGI+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM+LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 6. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 225.6 bits 790,  Expect = 3e-61
 Identities = 108/131 82%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMCEIEG HLSAAAI+GH+GSVWAQS +FP+LKPEEV GI+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGVVIRGKKG GG+T+KK+ M+L+IG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 7. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 225.3 bits 789,  Expect = 4e-61
 Identities = 106/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG HL++AAI+G+DGSVWAQS++FP+LKPEEVAGI+ DF +PGTL
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGM+L+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 8. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 224.8 bits 787,  Expect = 6e-61
 Identities = 107/130 82%, Positives = 124/130 95%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMC+I+G+HL+AAAI+GHDGSVWAQS SFP++KPEEVA I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 9. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 224.7 bits 787,  Expect = 7e-61
 Identities = 107/131 81%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HL CEI+GQHL++AAI+GHDGSVW +S +FP++KPEE+AGI+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM+LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 10. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 224.2 bits 785,  Expect = 9e-61
 Identities = 105/131 80%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMCEIEG HLSAAAI+GHDGSVWAQS +FP+LKPEEV GI+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KK+ ++L+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 11. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 223.3 bits 782,  Expect = 2e-60
 Identities = 108/131 82%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSW+AYVD+HL CEI+GQ+L++AAI+GHDGSVWAQS +FP++KPEE AGI+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM+LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 12. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 223.1 bits 781,  Expect = 2e-60
 Identities = 108/130 83%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HL++AAIVGHDG+ WAQS +FPE+KPEE+A I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG+GGIT+KKTG SLIIG+YDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 13. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 223.1 bits 781,  Expect = 2e-60
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEI+GQHL+AAAI+GHDGSVWAQS SFP++KPEE+A I+KDFDEPG+L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG GGIT+KKTG +LI G+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 14. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 222.8 bits 780,  Expect = 2e-60
 Identities = 103/131 78%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMCEIEG HL++AAI+G+DGSVWA+SE+FP+LKPEE+ GI+ DF+EPGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GG+KYMVIQGEPG VIRGKKG GG+T+KKT ++L+IG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 15. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 222.6 bits 779,  Expect = 3e-60
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HL++AAI+GHDG+VWAQS  FP++KPEE+ GI+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTG+FV G KYMVIQGEPG VIRGKKG GGITIKKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 16. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 222.3 bits 778,  Expect = 3e-60
 Identities = 106/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMCEI+GQHLS+AAI+GHD +VWAQS +FP++KPEE++ I+ DF+ PG+L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPGVVIRGKKGTGGIT+KKT ++LIIGVYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 17. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 222.0 bits 777,  Expect = 4e-60
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HL++AAIVGHDG+VWAQS +FP++KPEE+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 18. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 222.0 bits 777,  Expect = 4e-60
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HLS+AAIVGHDG+VWAQS +FP++KPEE+  IIKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            AP GLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L+IG+YDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 19. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 221.7 bits 776,  Expect = 5e-60
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HL++AAI+GHDG+VWAQS  FP++KPEE+ GI+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTG+FV G KYMVIQGEPG VIRGKKG GGITIKKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 20. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 221.7 bits 776,  Expect = 5e-60
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HL++AAI+GHDG+VWAQS  FP++KPEE+ GI+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTG+FV G KYMVIQGEPG VIRGKKG GGITIKKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 21. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 221.2 bits 774,  Expect = 7e-60
 Identities = 104/130 80%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMCEIEG+HL++AAI+GHDG+VWAQS +FP +KPEE+A I+KDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GG+T+KKTG +L+IG+YDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLIEQG 130
            +LGDYLIEQG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 22. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 221.2 bits 774,  Expect = 7e-60
 Identities = 105/131 80%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HL+C+I+GQ L+AAAIVGHDGSVWAQS++FP+ KPEE+A I+KDFDEPG+L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG+GG+TIKKT ++LIIG+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL +QGF
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 23. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 220.1 bits 770,  Expect = 2e-59
 Identities = 106/130 81%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVDEHLMCEIEG+HL+AAAIVGHDG+ WAQS +FPE+K E++A I+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 24. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 219.2 bits 767,  Expect = 3e-59
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMCEIEG HLSAAAI+G+DGSVWAQS +FP++K EE+ GI+ DF EPGTL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 25. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 218.9 bits 766,  Expect = 3e-59
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAY DEHLMCEIEG  L+AAAI+GHDGSVWAQS +FP+LKPEE+ G++ DF+EPG+L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 26. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 218.9 bits 766,  Expect = 3e-59
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMCE +GQHL+AAAI+GHDGSVWAQS +FP++KP E+A I+KDFDEPG+L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG GGIT+KKT  +LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 27. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 217.8 bits 762,  Expect = 7e-59
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMCEIEG+HL++AAI GHDG+VWAQS  FP++KPEE+ GI+KD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTG+FV   KYMVIQGEPG VIRGKKG GGITIKKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 28. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 215.6 bits 754,  Expect = 3e-58
 Identities = 101/131 77%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+I+G+ L+AAAI+GHDGSVWAQS SFP++K +EVA ++KDFDEPG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 29. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 215.3 bits 753,  Expect = 4e-58
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+IEG HLS+AAI+GHDG+VWAQS SFP+LKPEEV+ I+KDF+EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG GG+TIKKT  +LIIG+Y EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            R+GDYL+EQG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 30. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 215.3 bits 753,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMC+I+G  L+AAAI+G+DGSVW+QS SFP +KPEE+A I+KDFD+PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPG VIRGKKG+GGITIKKT  +L+IG+YDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 215.3 bits 753,  Expect = 4e-58
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEG---QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
            MSWQAYVD+HLMCE+EG   Q L+AAAI+GHDGSVWAQS +FP++KPEE+AGI+KDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
            G LAPTGL++GG KYMVIQGEP  VIRGKKG+GG+TIKKTG +L+ GVYDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLIEQGF 131
            +VERLGDYLI+QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 32. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 215.0 bits 752,  Expect = 5e-58
 Identities = 101/130 77%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+I+G+ L+AAAI+GHDGSVWAQS  FP++K +EVA ++KDFDEPG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGEPG VIRGKKG+GGIT+KKTG +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 33. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 215.0 bits 752,  Expect = 5e-58
 Identities = 104/130 80%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEGQ--HLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVD+HLMC+I+GQ  HL+AA+IVGHDGS+WAQS SFP+LKPEE+ GI+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
             LAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYLIEQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 34. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 214.5 bits 750,  Expect = 8e-58
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ Y DEHLMCEIEG  L+AAAI+GHDGSVWAQS +FP+LKPEE+ G++ DF+EPG+L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIR KKG GG+T+KKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 214.2 bits 749,  Expect = 9e-58
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVDEHLMCEI+G+HL+AAAI+GHDGSVWAQS SFP++K EE+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++G TKYMVIQGEPG VIRGKKG+GG+T+KKT  +LI G+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQG 130
            RLGDYLIEQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 36. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 213.7 bits 747,  Expect = 1e-57
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMC+I+G  L+AAAI+G+DGSVW+QS +FP +KPEE+A I+KDFD+PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGIT+KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 37. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 213.7 bits 747,  Expect = 1e-57
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HL+C+IEG HL+ AAI+G+DGSVWAQS  FP++KPEE+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTG +LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            R GDYLI+QG+
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 38. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 212.8 bits 744,  Expect = 2e-57
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HL+C IEG HL+ AAI+G+DGSVW QS  FP++KPEE+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTG +LIIG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 39. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 212.8 bits 744,  Expect = 2e-57
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEG---QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
            MSWQ YVD+HLMCE++G   Q+LSAAAI+GHDGSVWAQS +FP++KPEE+ GI+K+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
            G LAPTGL++GGTKYMVIQGEP  VIRGKKG+GG+TIKKTG +L+ GVYDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLIEQGF 131
            +VERLGDYLIEQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 40. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 212.5 bits 743,  Expect = 3e-57
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQAYVD+HLMCEIEG   HL+ AAI+G DGSVWAQS  FP++KP+E+A I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGL +GGTKYMVIQGEPG VIRGKKG GGI +KKTG +L++G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQGF 131
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 41. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 212.3 bits 742,  Expect = 4e-57
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+I+G+ L+AAAI+GHDGSVWAQS SFP++K +EVA I+KDFDEPG+L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +G TKYMVIQGEPG VIRGKKG+GGIT+KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 42. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 212.3 bits 742,  Expect = 4e-57
 Identities = 98/131 74%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMC+I+G+HL+AAAI+GHDGSVWAQS +FP++KPEE+  I+KDFDEPG+L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG+GG+T+KKT  +L+ G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 43. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 212.0 bits 741,  Expect = 4e-57
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+I+G  L+AAAI+G+DGSVW+QS +FP +KPEE+A I+KDFD+PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGIT+KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 44. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 212.0 bits 741,  Expect = 4e-57
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+I+G  L+AAAI+G+DGSVW+QS +FP +KPEE+A I+KDFD+PGTL
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGIT+KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 45. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 211.7 bits 740,  Expect = 5e-57
 Identities = 101/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMC+I+G  L+AAAI+G+DGSVW+QS +FP +KPEE+A I+KD+D+PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGIT+KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 210.6 bits 736,  Expect = 1e-56
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVD+HLMCEIEG   HLSAAAI+G DGSVWAQS SFP++KP+E++ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGL +GGTKYMVIQGEPG VIRGKKG GGI +KKTG +LIIG+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 47. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 210.3 bits 735,  Expect = 1e-56
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHLMC+++G+ L++AAI+GHDGSVWAQS  FPELKP E+  I+ DF+EPG+L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ M+LI G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 48. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 210.0 bits 734,  Expect = 2e-56
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+IEG HL++AAI+G+DGSVWAQS +FP++KPEE+  I+ DF EPGTL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG GGIT+KKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDY+IEQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 49. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 210.0 bits 734,  Expect = 2e-56
 Identities = 97/131 74%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+ LMC+I+G+HL+AAAI+GHDGSVWA+S +FP++KPEE+  I+KDFDEPG+L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG+GG+T+KKTG +L+ G+Y+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 50. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 210.0 bits 734,  Expect = 2e-56
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC+IEG  L++AAI+GHDGSVWA S SFP++  EEV+ I+KDF+EPG+L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEPG VIRGKKG+GG+T+KKT  +LIIGVYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 51. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 209.2 bits 731,  Expect = 3e-56
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMC++EG  L+AAAI+G+DGSVWAQS +FP+LKPEE+ GI  DF EPGTL
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGEP  VIRGKKG GG+TIKKT  +++ G+Y+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 52. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 208.7 bits 729,  Expect = 4e-56
 Identities = 100/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDE LMCEIEG HL+AAAI+G+DGSVWAQS +FP++K EE+  I+ DFDEPGTL
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL +GGTKYMVIQGE G VIRGKKG GG+T++KT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 53. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 208.4 bits 728,  Expect = 5e-56
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMCEIEG  L++AAI+G+DGSVWAQS +FP++KPEE+  I+ DF EPGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGE G VIRGKKG GGIT+KKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 54. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 207.8 bits 726,  Expect = 8e-56
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHL+CE EG HL++AAI+G+DG+VWAQS +FP++KPEE+ GI+ DF  PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP  VIRGKKG GGITIKKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 55. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 207.8 bits 726,  Expect = 8e-56
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVDEHL+CE EG HL++AAI+G+DG+VWAQS +FP++KPEE+ GI+ DF  PGTL
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEP  VIRGKKG GGITIKKT  +LIIG+YDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 56. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 207.8 bits 726,  Expect = 8e-56
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGQ--HLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVDEHLMC+I+GQ  HL+AAAI+GHDGS+WAQS SFP+LK +E+  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
             LAPTGL + GTKYMVIQGEPG VIRGKKG+GG+TIKKTG +LI G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGF 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 57. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 207.3 bits 724,  Expect = 1e-55
 Identities = 99/131 75%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQAYVD+HLMC+I+G  L+AAAI+G+DGSVW+QS +FP ++ EE+A I+KDFD+PGTL
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GGTKYMVIQGE G VIRGKKG+GGI +KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLIEQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 58. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 207.2 bits 724,  Expect = 1e-55
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 3/130 2%
Query  1    MSWQAYVDEHLMCEIEGQH---LSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
            MSWQAYVD+HLMC+IEG+    L+AAAIVGHDGSVWAQS +FP++KPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
            G LAPTGL +GGTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQG 130
            VVERLGDYL+EQG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 59. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 207.0 bits 723,  Expect = 1e-55
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQAYVDEHLMC+IEG  QHL++AAI+G DG+VWAQS  FP++KPEE+ GIIK+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG ++I+G+YDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 60. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 207.0 bits 723,  Expect = 1e-55
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGQH---LSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
            MSWQAYVD+HLMC+IEG+    L+AAAIVGHDGSVWAQS +FP++KPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
            G LAPTGL +GGTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGF 131
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 61. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 205.6 bits 718,  Expect = 4e-55
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQAYVDEHLMCEIEGQH---LSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
            MSWQAYVD+HLMC+IEG+    L+AAAIVGHDGSVWAQS +FP++KPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
            G LAPTGL +GGTKYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQGF 131
            V ERLGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 62. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 205.3 bits 717,  Expect = 4e-55
 Identities = 99/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            M WQ YVD+HLMCEIEG   HLS AAI+G DGSVWAQS SFP++KP+E+A ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGL +GGTKYMVIQGEPG  IRGKKG GGI +KKTG +L+ G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 63. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 204.5 bits 714,  Expect = 8e-55
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGQHLS--AAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVDEHLMC+I+GQ  +  A+AIVGHDGSVWAQS SFP++KP+E+ GI+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
             LAPTGL +GG KYMVIQGE G VIRGKKG+GGITIKKTG +L+ G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGF 131
            VERLGDYLI+QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 64. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 204.5 bits 714,  Expect = 8e-55
 Identities = 98/131 74%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIEGQ--HLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVDEHLMC+I+GQ  HL+AAAI+GHDGSVWAQS +FP++K EE++ I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
             LAPTGL +GGTKYMVIQGE G VIRGKKG+GG+TIKKT  +L+ G+Y+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLIEQGF 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 65. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 203.9 bits 712,  Expect = 1e-54
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQAYVDEHLMCEI-EGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGT 59
            MSWQAYVD+HLMC++ +G   ++AAI+GHDGSVWAQS +FP+LKPEEV GI+ DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVV 119
            LAPTGLF+GGTKYMVIQGE G VIRGKKG+GG T+KKTG +++IG+YDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLIEQGF 131
            ERLGDYL+EQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 66. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 203.9 bits 712,  Expect = 1e-54
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVD+HLMC+IEG   HL+ AAI+G DGSVWAQS +FP++KP+E+A I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGL +GGTKYMVIQGE G VIRGKKG GGI +KKTG +LI G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 67. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 202.5 bits 707,  Expect = 3e-54
 Identities = 95/131 72%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD HL+CEIEG HLS+AAI+G+DG VWAQS  FP++KPEE+  I+ DF EPG+L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGL++GGTKYMVIQGEPG +I GKKG GG+TI+KT  +LIIG+YD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLIEQGF 131
            RLGDYLI+ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 68. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 202.0 bits 705,  Expect = 4e-54
 Identities = 98/130 75%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVD+HLMCEIEG   HL+AAAI+G DGSVWAQS +FP++KP+E++ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGL +GGTKYMVIQGE G VIRGKKG GGI +KKTG +LI G+YDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 69. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 201.7 bits 704,  Expect = 6e-54
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 3/130 2%
Query  1    MSWQAYVDEHLMCEIEGQH---LSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEP 57
            MSWQAYVD+HLMC+IEG+    L+AAAIVGHDGSVWAQS +FP++KPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNM 117
            GTLAPTGL +GGTKYMVIQGE G VIRGKKG+GGITIKKT  +L+ G+Y+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLIEQG 130
            VV RLGD L++QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 70. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 200.9 bits 701,  Expect = 9e-54
 Identities = 97/128 75%, Positives = 113/128 88%, Gaps = 0/128 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ+YVD+HLMC++EG HL+AAAI+G+DGSVWAQS  FP+LKP+E+ GI KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
            APTGLF+GG KYMVIQGE G VIRGKKG GG+TIKKT  +L+ G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLIE 128
            RLGDYLIE
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 71. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 200.6 bits 700,  Expect = 1e-53
 Identities = 98/129 75%, Positives = 118/129 91%, Gaps = 2/129 1%
Query  1    MSWQAYVDEHLMCEI-EGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGT 59
            MSWQAYVD+HLMC++ +G  L++AAI+GHDGSVWAQS +FP+LKPEEV GI+ DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVV 119
            LAPTGLF+GGTKYMVIQGE G VI GKKG+GG T+KKTG +++IG+YDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLIEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 72. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 198.9 bits 694,  Expect = 4e-53
 Identities = 98/131 74%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQAYVDEHLMCEIE--GQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQAYVDEHLMC IE  G HL+++AIVG DGS+WAQS +FP++KP+E+  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGLF+GG KYMVIQGEPG VIRGKKG GG+ IKKT  +LI G+YDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQGF 131
            VERLGDYLIEQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 197.8 bits 690,  Expect = 8e-53
 Identities = 94/129 72%, Positives = 116/129 89%, Gaps = 2/129 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVD+HLMC+IEG  QHL+AAAI+G DG+VWA+S+ FPE+KPEE+ GII +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
            TLAPTGLF+GG KYMV+QGE G VIRGKKG GGI IKKTG ++++G+YDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLIEQ 129
            VERLGDYL++Q
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 74. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 196.4 bits 685,  Expect = 2e-52
 Identities = 95/130 73%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
            MSWQ YVD+HLMC+IEG  QHL++AAI G DG+VWA+S SFPE+KP E+  IIK+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
             LAPTGLF+GG KYMVIQGE G VIRGKKG GGI IKKTG +++ G+YDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLIEQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 171.3 bits 594,  Expect = 6e-45
 Identities = 80/109 73%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
            MSWQ YVD+HLMCEIEG +L++AAI+G+DGS+WAQS SFP++KPEE+  I+ DF EPGTL
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEP 109
            APTGL++GGTKYMVIQGE G VIRGKKG GG+T+KKT  +LIIG+YDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 147.1 bits 508,  Expect = 2e-37
 Identities = 98/131 74%, Positives = 121/131 92%, Gaps = 28/131 21%
Query  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPE------------------- 41
            MSWQ YVD+HLMC++EG+HL++AAI+G DGSVWAQS +FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------LKPEEVAGIIKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGI 92
                     +KPEE+  I+KDFDEPG LAPTGLF+GGTKYMVIQGEPG VIRGKKG+ GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTGMSLIIGVYDEPMTPGQCNMVVERLGDYLIEQGF 131
            TIKKTG +LI G+Y+EP+TPGQCNMVVE++GDYL++QG+
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 77.5 bits 257,  Expect = 1e-16
 Identities = 50/120 41%, Positives = 74/120 61%, Gaps = 12/120 10%
Query  1    MSWQAYVDEHLMCEIEGQHLSA--AAIVG-HDGSVWAQSES-FPELKPEEVAGIIKDF-- 54
            MSWQ+YVD ++ C    QH+    A I G +DG+VWA+ E  +P+   ++    I D   
Sbjct  1    MSWQSYVDNQI-C----QHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  55   DEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQ 114
              P ++   G+ +GG KY+ IQ +  +V RG+KG+  + I  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQADNSLV-RGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  115  CNMVVERLGDYL 126
             N VVE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.