The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL
APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE
RLGDYLVEQGF
Sequence Info Allergen Name Length Opt Bits Score E Value
P52184 Hor v 12.0101 131 919 252.1 3.7e-69
FM164277 Tri a 12.0104 131 869 238.7 3.9e-65
P49232 Tri a 12.0101 138 869 238.6 4.4e-65
P49233 Tri a 12.0102 141 864 237.2 1.1e-64
P49234 Tri a 12.0103 140 852 234.0 1e-63
Q9FR39 Zea m 12.0105 131 805 221.6 5.6e-60
O22655 Zea m 12.0104 131 799 220.0 1.7e-59
AAK54835 Ana c 1 131 793 218.4 5.2e-59
O24650 Phl p 12.0102 131 782 215.4 4e-58
CAA54686 Phl p 12.0101 131 779 214.6 6.9e-58
P35079 Phl p 12.0101 131 779 214.6 6.9e-58
P35081 Zea m 12.0101 131 775 213.5 1.5e-57
AAL07320 Lit c 1 131 773 213.0 2.1e-57
A0A2I4DNN6 Jug r 7.0101 131 772 212.7 2.5e-57
Q9M7N0 Hev b 8.0201 131 770 212.2 3.7e-57
Q9FUD1 Ory s 12.0101 131 769 211.9 4.4e-57
P35083 Zea m 12.0103 131 763 210.3 1.3e-56
O24282 Phl p 12.0103 131 763 210.3 1.3e-56
O04725 Cyn d 12 131 761 209.8 1.9e-56
AAL76933 Dau c 4 134 754 207.9 7.4e-56
AF377948 Mus a 1.0101 131 753 207.7 8.6e-56
AAP13533 Cuc m 2 131 751 207.1 1.2e-55
AAL92870 Che a 2 131 749 206.6 1.8e-55
Q9M7M8 Hev b 8.0203 131 749 206.6 1.8e-55
Q9XF41 Mal d 4 131 748 206.3 2.2e-55
Q9LEI8 Hev b 8.0204 131 747 206.1 2.6e-55
CAD37202 Pru p 4.0201 131 745 205.5 3.8e-55
Q5XWE1 Citr l 2.0101 131 745 205.5 3.8e-55
O49894 Mer a 1 133 743 205.0 5.6e-55
O65810 Gly m 3 131 742 204.7 6.6e-55
Q9XF37 Api g 4 134 742 204.7 6.9e-55
Q9XF42 Mal d 4 131 741 204.5 7.9e-55
P35082 Zea m 12.0102 131 740 204.2 9.5e-55
O65809 Gly m 3 131 737 203.4 1.7e-54
Q9STB6 Hev b 8.0102 131 736 203.1 2e-54
Q9XF38 Pyr c 4 131 735 202.9 2.4e-54
Q9M7M9 Hev b 8.0202 131 735 202.9 2.4e-54
Q8L5D8 Pho d 2.0101 131 734 202.6 2.9e-54
ACP43298 Ama r 2.0101 133 734 202.6 3e-54
CAD37201 Pru p 4.0101 131 733 202.3 3.5e-54
AAL29690 Lyc e 1 131 733 202.3 3.5e-54
AY081852 Pru du 4.0102 131 732 202.1 4.2e-54
AY081850 Pru du 4.0101 131 732 202.1 4.2e-54
Q9XF40 Mal d 4 131 727 200.7 1.1e-53
Q9XF39 Pru av 4 131 726 200.4 1.3e-53
QVU02258 Que ac 2.0101 133 726 200.4 1.3e-53
Q93YG7 Sola l 1.0101 131 722 199.4 2.7e-53
Q5EF31 Cro s 1.0101 131 722 199.4 2.7e-53
CAD10377 Lyc e 1 131 722 199.4 2.7e-53
XP030492464 Can s 2.0101 133 721 199.1 3.3e-53
O24169 Ole e 2 134 720 198.8 4.1e-53
CAD10376 Cap a 2 131 719 198.6 4.7e-53
A0A0A0REA1 Koc s 2.0101 133 719 198.6 4.8e-53
A0A023W2L7 Pro j 2.0101 133 719 198.6 4.8e-53
Q9AXH4 Cor a 2 131 718 198.3 5.6e-53
QID21357 Pop n 2.0101 131 718 198.3 5.6e-53
O24170 Ole e 2 134 717 198.0 7.1e-53
P25816 Bet v 2 133 716 197.8 8.4e-53
ABU95412 Sin a 4.0101 131 715 197.5 9.8e-53
AAK01235 Cor a 2 131 712 196.7 1.7e-52
O24171 Ole e 2 134 712 196.7 1.8e-52
O65812 Hev b 8.0101 131 710 196.2 2.5e-52
P84177 Cit s 2.0101 131 710 196.2 2.5e-52
Q9SQI9 Ara h 5 131 709 195.9 3e-52
Q9XG85 Par j 3 132 708 195.6 3.6e-52
ACS34771 Sal k 4.0101 133 708 195.6 3.7e-52
A0A0A0RCW1 Aca f 2 133 708 195.6 3.7e-52
O81982 Hel a 2 133 703 194.3 9.3e-52
Q9T0M8 Par j 3 131 696 192.4 3.3e-51
Q42449 Ara t 8 131 695 192.2 4e-51
AJ421030 Art v 4.0101 133 685 189.5 2.6e-50
QRN65366 Lig v 2.0101 134 681 188.4 5.6e-50
AJ421031 Art v 4.0201 133 678 187.6 9.6e-50
ADK22841 Sal k 4.0201 133 666 184.4 8.9e-49
FG438715 Act d 9.0101 109 588 163.8 1.1e-42
QEQ43417 Sola m 1.0101 159 519 144.8 8.5e-37
A0A1B2YLJ4 Tyr p 36.0101 131 259 75.6 4.9e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 252.1 bits 919,  Expect = 4e-69
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYLVEQGF
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 2. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 238.7 bits 869,  Expect = 4e-65
 Identities = 121/131 92%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSW+ YVDDHLCCEIDGQHLTSAAILGHDG VW QSPNFPQFKPEEIAGI+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 3. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 238.6 bits 869,  Expect = 4e-65
 Identities = 121/131 92%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHLCCEIDGQHLTSAAILGHDG VW +SPNFP+FKPEEIAGI+KDF+EPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 4. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 237.2 bits 864,  Expect = 1e-64
 Identities = 120/131 91%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHLCCEIDGQHLTSAAILGHDG VW +SPNFP+FKPEEIAGI+KDF+EPGHL
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 5. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 234.0 bits 852,  Expect = 1e-63
 Identities = 119/131 90%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSW+ YVDDHLCCEIDGQ+LTSAAILGHDG VW QSPNFPQFKPEE AGI+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LILGIYDEPMTPGQCNLVVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 6. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 221.6 bits 805,  Expect = 6e-60
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+I+GQHL++AAI+GHDG VW QS NFP++KPEE+AG+IKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 7. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 220.0 bits 799,  Expect = 2e-59
 Identities = 110/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVD+HL CEI+GQHL++AAI+GHDG VW QS +FP++KPEE+AGIIKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLF+GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGM LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 8. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 218.4 bits 793,  Expect = 5e-59
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL CEIDGQHL+SAAILGHD  VW QSPNFPQFKPEEI+ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKGTGGIT+KKT + LI+G+YDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQGF
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 9. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 215.4 bits 782,  Expect = 4e-58
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL SAAILGHDG VW QS +FPQFKPEEI GI+KDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYLVEQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 10. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 214.6 bits 779,  Expect = 7e-58
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL SAAILGHDG VW QS +FPQFKPEEI GI+KDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYLVEQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 11. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 214.6 bits 779,  Expect = 7e-58
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL SAAILGHDG VW QS +FPQFKPEEI GI+KDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYLVEQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 12. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 213.5 bits 775,  Expect = 1e-57
 Identities = 108/130 83%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HLTSAAI+GHDG  W QS  FP+FKPEE+A I+KDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG  LI+GIYDEPMTPGQCNLVVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 13. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 213.0 bits 773,  Expect = 2e-57
 Identities = 109/131 83%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL CE DGQHLT+AAI+GHDG VW QS NFPQFKP EIA I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GGIT+KKT   LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 14. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 212.7 bits 772,  Expect = 3e-57
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEIDGQHLT+AAI+GHDG VW QS +FPQFKPEEIA I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GGIT+KKTG  LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 15. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 212.2 bits 770,  Expect = 4e-57
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL C+IDG+HLT+AAI+GHDG VW QS +FPQFKPEE+A I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG  LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 16. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 211.9 bits 769,  Expect = 4e-57
 Identities = 107/131 81%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HLTSAAI+GHDG VW QS  FPQFKPEE+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 17. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 210.3 bits 763,  Expect = 1e-56
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL+SAAI+GHDG VW QS  FPQFKPEE+  IIKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 18. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 210.3 bits 763,  Expect = 1e-56
 Identities = 105/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL SAAI+GHDG VW QS +FPQFKPEEI GI+KD+DEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTG+F+   KYMVIQGEPG VIRGKKG GGITIKKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYLVEQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 19. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 209.8 bits 761,  Expect = 2e-56
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL CEI+G+HLTSAAI+GHDG VW QS  FP FKPEE+A I+KDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GG+T+KKTG  L++GIYDEPMTPGQCN+V+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLVEQG 130
            +LGDYL+EQG
Sbjct  121  KLGDYLIEQG 130

Sequence Alignment: 20. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 207.9 bits 754,  Expect = 7e-56
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLCCEIDG---QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
            MSWQTYVDDHL CE+DG   Q+L++AAI+GHDG VW QS  FP+FKPEEI GI+K+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
            GHLAPTGL+LGGTKYMVIQGEP  VIRGKKG+GG+TIKKTG  L++G+YDEP+TPGQCNL
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLVEQGF 131
            +VERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 21. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 207.7 bits 753,  Expect = 9e-56
 Identities = 105/131 80%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDGQ LT+AAI+GHDG VW QS  FPQ KPEEIA I+KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG+GG+TIKKT + LI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL +QGF
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 22. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 207.1 bits 751,  Expect = 1e-55
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVD+HL CEI+G HLTSAAI+G+DG VW QS NFPQ+KPEE+AGI+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKTGM L++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 23. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 206.6 bits 749,  Expect = 2e-55
 Identities = 104/130 80%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL C+I+G HL+SAAILGHDG VW QSP+FPQ+KPEE++ I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG GG+TIKKT   LI+GIY EPMTPGQCN+VVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            R+GDYLVEQG
Sbjct  121  RIGDYLVEQG 130

Sequence Alignment: 24. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 206.6 bits 749,  Expect = 2e-55
 Identities = 102/130 78%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL C+IDG+ LT+AAI+GHDG VW QS  FPQFK +E+A ++KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG  LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 25. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 206.3 bits 748,  Expect = 2e-55
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL CEI+G HL++AAI+GH+G VW QS  FPQ+KPEE+ GI+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPGVVIRGKKG GG+T+KK+ M L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 26. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 206.1 bits 747,  Expect = 3e-55
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL C+IDG+ LT+AAI+GHDG VW QS +FPQFK +E+A ++KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGEPG VIRGKKG+GGIT+KKTG  LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 27. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 205.5 bits 745,  Expect = 4e-55
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL CEI+G HL++AAI+GHDG VW QS  FPQ+KPEE+ GI+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KK+ + L++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 28. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 205.5 bits 745,  Expect = 4e-55
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL CEI+G HLTSAAI+G+DG VW +S NFPQ+KPEEI GI+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL++GG+KYMVIQGEPG VIRGKKG GG+T+KKT + L++GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 29. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 205.0 bits 743,  Expect = 6e-55
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVDDHL C+IDGQ  HL +A+I+GHDG +W QS +FPQ+KPEEI GI+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
            HLAPTGL++ GTKYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 30. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 204.7 bits 742,  Expect = 7e-55
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C I+G HLT AAI+G+DG VW+QS +FPQFKPEEI  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG  LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 31. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 204.7 bits 742,  Expect = 7e-55
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLCCEIDG---QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
            MSWQ YVDDHL CE++G   Q LT+AAI+GHDG VW QS  FPQ KPEEIAGI+KDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
            GHLAPTGL+LGG KYMVIQGEP  VIRGKKG+GG+TIKKTG  L++G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLVEQGF 131
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 32. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 204.5 bits 741,  Expect = 8e-55
 Identities = 104/131 79%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS +FP FKPEEIA I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GGITIKKT   L++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 204.2 bits 740,  Expect = 1e-54
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVD+HL CEI+G+HL +AAI+GHDG  W QS  FP+FK E++A I+KDFDEPGHL
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 34. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 203.4 bits 737,  Expect = 2e-54
 Identities = 100/131 76%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+I+G HLT AAI+G+DG VW QS +FPQFKPEEI  I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKTG  LI+GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            R GDYL++QG+
Sbjct  121  RPGDYLIDQGY 131

Sequence Alignment: 35. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 203.1 bits 736,  Expect = 2e-54
 Identities = 99/131 75%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL CEI+G HL++AAI+G+DG VW QS NFPQFK EEI GI+ DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL++GGTKYMVIQGEPG VIRGKKG GG+T+KKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGY 131

Sequence Alignment: 36. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 202.9 bits 735,  Expect = 2e-54
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG+HLT+AAILGHDG VW QS  FP+FKPEEI  I+KDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKT   L++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 37. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 202.9 bits 735,  Expect = 2e-54
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL C+IDG+ LT+AAI+GHDG VW QS +FPQFK +E+A I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 38. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 202.6 bits 734,  Expect = 3e-54
 Identities = 101/130 77%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVD+HL CEIDG+HLT+AAILGHDG VW QS +FPQFK EEI  I+ DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GG+T+KKT   LI+GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 39. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 202.6 bits 734,  Expect = 3e-54
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQ YVDDHL CEI+G   HLT AAILG DG VW QS +FPQFKP+EIA I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG  L++GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGF 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGY 133

Sequence Alignment: 40. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 202.3 bits 733,  Expect = 3e-54
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS  FP FKPEEIA I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 41. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 202.3 bits 733,  Expect = 3e-54
 Identities = 102/131 77%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL C+I+G HLTSAAI+G+DG VW QS NFPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GGIT+KKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 42. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 202.1 bits 732,  Expect = 4e-54
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS  FP FKPEEIA I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 202.1 bits 732,  Expect = 4e-54
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS  FP FKPEEIA I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 44. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 200.7 bits 727,  Expect = 1e-53
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDD L C+IDG+HLT+AAILGHDG VW +S  FP+FKPEEI  I+KDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG+GG+T+KKTG  L++GIY+EP+TPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 45. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 200.4 bits 726,  Expect = 1e-53
 Identities = 101/131 77%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS  FP FKPEEIA I+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGIT+KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 200.4 bits 726,  Expect = 1e-53
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVD+HL C+IDGQ  HL +AAI+GHDG VW QS NFPQFK EEI+ I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
            HLAPTGL LGGTKYMVIQGE G VIRGKKG+GG+TIKKT   L++GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGF 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 47. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 199.4 bits 722,  Expect = 3e-53
 Identities = 102/131 77%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CE +G HLTSAAI+G+DG VW QS NFPQFKPEEI GI+ DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 48. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 199.4 bits 722,  Expect = 3e-53
 Identities = 98/131 74%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL C++DG+ LTSAAILGHDG VW QS  FP++KP EI  I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTG+++ G KYMVIQGEPGVVIRGKKG+GG+TIKK+ M LI+G+YDEPMTPGQCNLVVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGY 131

Sequence Alignment: 49. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 199.4 bits 722,  Expect = 3e-53
 Identities = 102/131 77%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CE +G HLTSAAI+G+DG VW QS NFPQFKPEEI GI+ DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEP  VIRGKKG GGITIKKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 50. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 199.1 bits 721,  Expect = 3e-53
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLCCEIDGQ--HLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVD+HL C+IDGQ  HLT+AAI+GHDG +W QS +FPQ+K +EI  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
            HLAPTGL L GTKYMVIQGEPG VIRGKKG+GG+TIKKTG  LI+GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGF 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 51. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 198.8 bits 720,  Expect = 4e-53
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 3/130 2%
Query  1    MSWQTYVDDHLCCEIDGQH---LTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
            MSWQ YVDDHL C+I+G+    LT+AAI+GHDG VW QS  FPQFKPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQG 130
            VVERLGDYLVEQG
Sbjct  121  VVERLGDYLVEQG 133

Sequence Alignment: 52. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 198.6 bits 719,  Expect = 5e-53
 Identities = 101/131 77%, Positives = 112/131 85%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL CEI+G  LTSAAI+G+DG VW QS  FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGE G VIRGKKG GGIT+KKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 53. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 198.6 bits 719,  Expect = 5e-53
 Identities = 104/130 80%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVDDHL C+I+G   HLT AAILG DG VW QS NFPQFKP+EIA I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG  LI+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYLVEQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 54. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 198.6 bits 719,  Expect = 5e-53
 Identities = 102/130 78%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVDDHL CEI+G   HL++AAILG DG VW QS +FPQFKP+EI+ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG VIRGKKG GGI +KKTG  LI+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYLVEQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 55. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 198.3 bits 718,  Expect = 6e-53
 Identities = 96/131 73%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ Y D+HL CEI+G  L +AAI+GHDG VW QS  FPQ+KPEEI G++ DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIRGKKG GG+T+KKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 56. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 198.3 bits 718,  Expect = 6e-53
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+I+G  LTSAAI+GHDG VW  S +FPQF  EE++ I+KDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGEPG VIRGKKG+GG+T+KKT   LI+G+YDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 57. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 198.0 bits 717,  Expect = 7e-53
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLCCEIDGQH---LTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
            MSWQ YVDDHL C+I+G+    LT+AAI+GHDG VW QS  FPQFKPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGF 131
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 58. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 197.8 bits 716,  Expect = 8e-53
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLCCEIDGQHLTS--AAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVD+HL C+IDGQ   S  +AI+GHDG VW QS +FPQFKP+EI GI+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
            HLAPTGL LGG KYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+V
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGF 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 59. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 197.5 bits 715,  Expect = 1e-52
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL C+++G  LT+AAILG+DG VW QS NFPQ+KPEEI GI  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLF+GGTKYMVIQGEP  VIRGKKG GG+TIKKT   +++GIY+EPMTPGQCN+VVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 60. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 196.7 bits 712,  Expect = 2e-52
 Identities = 96/131 73%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTY D+HL CEI+G  L +AAI+GHDG VW QS  FPQ+KPEEI G++ DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG VIR KKG GG+T+KKT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 61. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 196.7 bits 712,  Expect = 2e-52
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLCCEIDGQH---LTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
            MSWQ YVDDHL C+I+G+    LT+AAI+GHDG VW QS  FPQFKPEE+ GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
            GHLAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKTG  L++GIY+EP+TPGQCN+
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGF 131
            V ERLGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 62. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 196.2 bits 710,  Expect = 2e-52
 Identities = 99/130 76%, Positives = 112/130 86%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+ L CEI+G HLT+AAI+G+DG VW QS NFPQFK EEI  I+ DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL LGGTKYMVIQGE G VIRGKKG GG+T++KT   LI+GIYDEPMTPGQCN++VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 63. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 196.2 bits 710,  Expect = 2e-52
 Identities = 99/131 75%, Positives = 113/131 86%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ YVDDHL C+IDG  LT+AAILG+DG VW QS  FP F+ EEIA I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGGTKYMVIQGE G VIRGKKG+GGI +KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 64. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 195.9 bits 709,  Expect = 3e-52
 Identities = 97/131 74%, Positives = 114/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVD+HL CEI+G HL+SAAILG+DG VW QS +FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGL+LGGTKYMVIQGEPG +I GKKG GG+TI+KT   LI+GIYD+PMTPGQCN++VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGF 131
            RLGDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 65. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 195.6 bits 708,  Expect = 4e-52
 Identities = 99/131 75%, Positives = 113/131 86%, Gaps = 1/131 0%
Query  1    MSWQTYVDDHLCCEI-DGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGH 59
            MSWQ YVDDHL C++ DG    SAAI+GHDG VW QS NFPQ+KPEE+ GI+ DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VIRGKKG+GG T+KKTG  +++GIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLVEQGF 131
            ERLGDYL+EQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 66. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 195.6 bits 708,  Expect = 4e-52
 Identities = 102/130 78%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVDDHL CEI+G   HLT+AAILG DG VW QS NFPQFKP+EI+ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG  LI+GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYLVEQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 67. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 195.6 bits 708,  Expect = 4e-52
 Identities = 100/130 76%, Positives = 112/130 86%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            M WQTYVDDHL CEI+G   HL+ AAILG DG VW QS +FPQFKP+EIA ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGL LGGTKYMVIQGEPG  IRGKKG GGI +KKTG  L++GIYDEP+TPGQCN++
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYLVEQG
Sbjct  121  VERLGDYLVEQG 132

Sequence Alignment: 68. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 194.3 bits 703,  Expect = 9e-52
 Identities = 99/130 76%, Positives = 112/130 86%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQ YVD+HL C+I+G  QHLTSAAILG DG VW QS  FPQFKPEE+ GIIK+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTG+F+ G KYMV+QGEPG VIRGKKG GGI IKKTG  +I+GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLLEQG 132

Sequence Alignment: 69. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 192.4 bits 696,  Expect = 3e-51
 Identities = 99/129 76%, Positives = 112/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLCCEI-DGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGH 59
            MSWQ YVDDHL C++ DG  L SAAI+GHDG VW QS NFPQ+KPEE+ GI+ DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVV 119
            LAPTGLFLGGTKYMVIQGE G VI GKKG+GG T+KKTG  +++GIYDEPMTPGQCNLVV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLVEQG 130
            ERLGDYL+EQG
Sbjct  120  ERLGDYLLEQG 130

Sequence Alignment: 70. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 192.2 bits 695,  Expect = 4e-51
 Identities = 97/128 75%, Positives = 110/128 85%, Gaps = 0/128 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQ+YVDDHL C+++G HLT+AAILG+DG VW QS  FPQ+KP+EI GI KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
            APTGLFLGG KYMVIQGE G VIRGKKG GG+TIKKT   L++G YDEPMT GQCNLVVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLVE 128
            RLGDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 71. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 189.5 bits 685,  Expect = 3e-50
 Identities = 97/130 74%, Positives = 113/130 86%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVDDHL C+I+G  QHLTSAAI+G DG VW +S +FP+FKP EI  IIK+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
            +LAPTGLFLGG KYMVIQGE G VIRGKKG GGI IKKTG  +++GIYDEP+ PGQCN+V
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQG 130
            VERLGDYL++QG
Sbjct  121  VERLGDYLLDQG 132

Sequence Alignment: 72. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 188.4 bits 681,  Expect = 6e-50
 Identities = 98/130 75%, Positives = 112/130 86%, Gaps = 3/130 2%
Query  1    MSWQTYVDDHLCCEIDGQH---LTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEP 57
            MSWQ YVDDHL C+I+G+    LT+AAI+GHDG VW QS  FPQFKPEEI GI+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNL 117
            G LAPTGL LGGTKYMVIQGE G VIRGKKG+GGITIKKT   L++GIY+EP+TPGQCN+
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQG 130
            VV RLGD LV+QG
Sbjct  121  VVWRLGDRLVQQG 133

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 187.6 bits 678,  Expect = 1e-49
 Identities = 95/129 73%, Positives = 111/129 86%, Gaps = 2/129 1%
Query  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQTYVDDHL C+I+G  QHLT+AAILG DG VW +S  FP+FKPEE+ GII +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMV+QGE G VIRGKKG GGI IKKTG  +++GIYDEP+ PGQCN++
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLVEQ 129
            VERLGDYLV+Q
Sbjct  121  VERLGDYLVDQ 131

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 184.4 bits 666,  Expect = 9e-49
 Identities = 95/131 72%, Positives = 108/131 82%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLCCEID--GQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
            MSWQ YVD+HL C I+  G HLTS+AI+G DG +W QS NFPQ KP+EI  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
             LAPTGLFLGG KYMVIQGEPG VIRGKKG GG+ IKKT   LI+GIYDEP+ PGQCN+V
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGF 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 163.8 bits 588,  Expect = 1e-42
 Identities = 82/109 75%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
            MSWQTYVDDHL CEI+G +LTSAAI+G+DG +W QS +FPQFKPEEI  I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEP 109
            APTGL+LGGTKYMVIQGE G VIRGKKG GG+T+KKT   LI+GIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 144.8 bits 519,  Expect = 9e-37
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 28/131 21%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQ------------------- 41
            MSWQTYVDDHL C+++G+HL SAAILG DG VW QSP FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEIAGIIKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGI 92
                     FKPEEI  I+KDFDEPG LAPTGLFLGGTKYMVIQGEPG VIRGKKG+ GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTGMPLILGIYDEPMTPGQCNLVVERLGDYLVEQGF 131
            TIKKTG  LI+GIY+EP+TPGQCN+VVE++GDYLV+QG+
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQGY 159

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 75.6 bits 259,  Expect = 5e-16
 Identities = 49/122 40%, Positives = 72/122 59%, Gaps = 8/122 6%
Query  1    MSWQTYVDDHLCCEIDGQHLTSAAILG-HDGRVWVQ-SPNFP-QFKPEEIAGIIKDF-DE 56
            MSWQ+YVD+++C  +D +    A I G +DG VW +   ++P Q   +E+  I       
Sbjct  1    MSWQSYVDNQICQHVDCRL---AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCN 116
            P  +   G+ LGG KY+ IQ +  +V RG+KG+  + I  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQADNSLV-RGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  LVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.