The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL
APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE
RLGDYLLEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9M7M9 Hev b 8.0202 131 887 255.4 3.7e-70
Q9M7M8 Hev b 8.0203 131 871 250.9 8.3e-69
Q9LEI8 Hev b 8.0204 131 868 250.1 1.5e-68
Q9M7N0 Hev b 8.0201 131 852 245.6 3.3e-67
A0A2I4DNN6 Jug r 7.0101 131 808 233.2 1.8e-63
Q9XF38 Pyr c 4 131 805 232.4 3.2e-63
AAL07320 Lit c 1 131 805 232.4 3.2e-63
Q8L5D8 Pho d 2.0101 131 800 231.0 8.3e-63
Q9XF42 Mal d 4 131 784 226.5 1.9e-61
Q9XF40 Mal d 4 131 784 226.5 1.9e-61
QID21357 Pop n 2.0101 131 781 225.6 3.4e-61
CAD37201 Pru p 4.0101 131 780 225.3 4.1e-61
AY081852 Pru du 4.0102 131 779 225.1 5e-61
P35081 Zea m 12.0101 131 779 225.1 5e-61
AY081850 Pru du 4.0101 131 779 225.1 5e-61
O65812 Hev b 8.0101 131 777 224.5 7.4e-61
Q9FUD1 Ory s 12.0101 131 776 224.2 8.9e-61
O04725 Cyn d 12 131 775 223.9 1.1e-60
AAL92870 Che a 2 131 774 223.7 1.3e-60
P35082 Zea m 12.0102 131 774 223.7 1.3e-60
Q9XF39 Pru av 4 131 773 223.4 1.6e-60
AF377948 Mus a 1.0101 131 773 223.4 1.6e-60
AAL29690 Lyc e 1 131 771 222.8 2.4e-60
P84177 Cit s 2.0101 131 769 222.2 3.5e-60
P35083 Zea m 12.0103 131 763 220.6 1.1e-59
O24169 Ole e 2 134 763 220.6 1.2e-59
O24170 Ole e 2 134 763 220.6 1.2e-59
Q9AXH4 Cor a 2 131 762 220.3 1.4e-59
QVU02258 Que ac 2.0101 133 761 220.0 1.7e-59
CAD10376 Cap a 2 131 758 219.2 3e-59
O24171 Ole e 2 134 758 219.2 3.1e-59
Q9STB6 Hev b 8.0102 131 756 218.6 4.4e-59
AAK01235 Cor a 2 131 756 218.6 4.4e-59
O24650 Phl p 12.0102 131 755 218.3 5.3e-59
A0A023W2L7 Pro j 2.0101 133 755 218.3 5.4e-59
CAD37202 Pru p 4.0201 131 751 217.2 1.2e-58
ACP43298 Ama r 2.0101 133 751 217.2 1.2e-58
XP030492464 Can s 2.0101 133 750 216.9 1.4e-58
AAL76933 Dau c 4 134 749 216.6 1.8e-58
CAA54686 Phl p 12.0101 131 748 216.3 2.1e-58
P35079 Phl p 12.0101 131 748 216.3 2.1e-58
QRN65366 Lig v 2.0101 134 748 216.3 2.1e-58
O24282 Phl p 12.0103 131 747 216.1 2.5e-58
A0A0A0REA1 Koc s 2.0101 133 747 216.1 2.6e-58
Q9XF41 Mal d 4 131 746 215.8 3.1e-58
AAK54835 Ana c 1 131 745 215.5 3.7e-58
O49894 Mer a 1 133 745 215.5 3.8e-58
Q9FR39 Zea m 12.0105 131 744 215.2 4.5e-58
O65809 Gly m 3 131 743 214.9 5.5e-58
O22655 Zea m 12.0104 131 742 214.7 6.7e-58
Q9XF37 Api g 4 134 740 214.1 1e-57
P25816 Bet v 2 133 738 213.5 1.5e-57
O65810 Gly m 3 131 736 213.0 2.2e-57
P52184 Hor v 12.0101 131 735 212.7 2.6e-57
A0A0A0RCW1 Aca f 2 133 735 212.7 2.7e-57
FM164277 Tri a 12.0104 131 732 211.9 4.7e-57
ABU95412 Sin a 4.0101 131 730 211.3 6.9e-57
ACS34771 Sal k 4.0101 133 730 211.3 7.1e-57
Q5XWE1 Citr l 2.0101 131 728 210.7 1e-56
P49232 Tri a 12.0101 138 727 210.4 1.3e-56
P49233 Tri a 12.0102 141 727 210.4 1.4e-56
Q5EF31 Cro s 1.0101 131 725 209.9 1.8e-56
P49234 Tri a 12.0103 140 724 209.6 2.4e-56
AAP13533 Cuc m 2 131 722 209.0 3.3e-56
Q9SQI9 Ara h 5 131 716 207.4 1.1e-55
CAD10377 Lyc e 1 131 714 206.8 1.6e-55
Q93YG7 Sola l 1.0101 131 714 206.8 1.6e-55
Q9XG85 Par j 3 132 709 205.4 4.2e-55
Q9T0M8 Par j 3 131 702 203.4 1.6e-54
AJ421030 Art v 4.0101 133 690 200.1 1.7e-53
O81982 Hel a 2 133 688 199.5 2.5e-53
Q42449 Ara t 8 131 683 198.1 6.5e-53
ADK22841 Sal k 4.0201 133 680 197.2 1.2e-52
AJ421031 Art v 4.0201 133 664 192.7 2.7e-51
FG438715 Act d 9.0101 109 618 179.9 1.7e-47
QEQ43417 Sola m 1.0101 159 494 144.9 7.9e-37
A0A1B2YLJ4 Tyr p 36.0101 131 275 83.5 2.1e-18
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 255.4 bits 887,  Expect = 4e-70
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 2. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 250.9 bits 871,  Expect = 8e-69
 Identities = 127/131 96%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSS FPQFKSDEVAA+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGEPGAVIRGKKGSGGITVKKT QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 3. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 250.1 bits 868,  Expect = 1e-68
 Identities = 126/131 96%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAA+MKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGEPGAVIRGKKGSGGITVKKT QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLL+QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 4. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 245.6 bits 852,  Expect = 3e-67
 Identities = 125/131 95%, Positives = 127/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCDIDGH LTAAAIIGHDGSVWAQSSSFPQFK +EVAAIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGEPGAVIRGKKGSGGITVKKT QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 5. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 233.2 bits 808,  Expect = 2e-63
 Identities = 117/131 89%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+IDG+ LTAAAIIGHDGSVWAQSSSFPQFK +E+AAIMKDFDEPGSL
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGE GAVIRGKKG+GGITVKKT QALI GIYDEPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 232.4 bits 805,  Expect = 3e-63
 Identities = 113/131 86%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDGH LTAAAI+GHDGSVWAQSS+FP+FK +E+ AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGE GAVIRGKKGSGG+TVKKTSQAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 7. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 232.4 bits 805,  Expect = 3e-63
 Identities = 114/131 87%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+ DG+ LTAAAIIGHDGSVWAQS++FPQFK  E+AAIMKDFDEPGSL
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGEPGAVIRGKKG GGITVKKT+QALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 8. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 231.0 bits 800,  Expect = 8e-63
 Identities = 112/131 85%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVD+HLMC+IDGH LTAAAI+GHDGSVWAQSSSFPQFKS+E+  IM DF+EPGSL
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LGSTKYMVIQGEPGAVIRGKKGSGG+TVKKT+QALI GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 9. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 226.5 bits 784,  Expect = 2e-61
 Identities = 109/131 83%, Positives = 126/131 96%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS+SFP FK +E+AAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGIT+KKTSQAL+IGIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 10. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 226.5 bits 784,  Expect = 2e-61
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDD LMCDIDGH LTAAAI+GHDGSVWA+SS+FP+FK +E+ AIMKDFDEPGSL
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGE GAVIRGKKGSGG+TVKKT QAL+ GIY+EPLTPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 11. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 225.6 bits 781,  Expect = 3e-61
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDI+G+ LT+AAIIGHDGSVWA S+SFPQF  +EV+AIMKDF+EPGSL
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT+QALIIG+YDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 12. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 225.3 bits 780,  Expect = 4e-61
 Identities = 111/131 84%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP FK +E+AAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGITVKKT+QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 13. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 225.1 bits 779,  Expect = 5e-61
 Identities = 111/131 84%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP FK +E+AAI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGITVKKT+QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 14. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 225.1 bits 779,  Expect = 5e-61
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+ WAQS++FP+FK +E+AAIMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT Q+LIIGIYDEP+TPGQCN++VE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 15. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 225.1 bits 779,  Expect = 5e-61
 Identities = 111/131 84%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP FK +E+AAI+KDFD+PG+L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGITVKKT+QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 16. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 224.5 bits 777,  Expect = 7e-61
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+ LMC+I+G+ LTAAAIIG+DGSVWAQSS+FPQFKS+E+ AIM DFDEPG+L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGE GAVIRGKKG GG+TV+KT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 17. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 224.2 bits 776,  Expect = 9e-61
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH LT+AAI+GHDG+VWAQS++FPQFK +E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 18. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 223.9 bits 775,  Expect = 1e-60
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+I+GH LT+AAIIGHDG+VWAQS++FP FK +E+A IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+IGIYDEP+TPGQCNM++E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLLEQGM 131
            +LGDYL+EQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 19. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 223.7 bits 774,  Expect = 1e-60
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCDI+G+ L++AAI+GHDG+VWAQS SFPQ+K +EV+AIMKDF+EPGSL
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGEPG VIRGKKG GG+T+KKT+QALIIGIY EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            R+GDYL+EQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 20. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 223.7 bits 774,  Expect = 1e-60
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVD+HLMC+I+GH L AAAI+GHDG+ WAQS++FP+FK++++A IMKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYLLEQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 21. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 223.4 bits 773,  Expect = 2e-60
 Identities = 110/131 83%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP FK +E+AAI+KD+D+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGITVKKT+QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 22. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 223.4 bits 773,  Expect = 2e-60
 Identities = 108/130 83%, Positives = 123/130 94%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDIDG+ LTAAAI+GHDGSVWAQS +FPQ K +E+AAIMKDFDEPGSL
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT+ ALIIGIY+EP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 23. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 222.8 bits 771,  Expect = 2e-60
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCDI+G+ LT+AAIIG+DGSVWAQS++FPQFK +E+ AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGLHLG TKYMVIQGE GAVIRGKKG+GGITVKKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 24. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 222.2 bits 769,  Expect = 3e-60
 Identities = 109/131 83%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMCDIDG+RLTAAAI+G+DGSVW+QS++FP F+ +E+AAI+KDFD+PG+L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGE GAVIRGKKGSGGI VKKT+QALIIGIYDEPLTPGQCNMIVE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 25. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 220.6 bits 763,  Expect = 1e-59
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH L++AAI+GHDG+VWAQS++FPQFK +E+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 26. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 220.6 bits 763,  Expect = 1e-59
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIDGH---RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
            MSWQ YVDDHLMCDI+GH   RLTAAAI+GHDGSVWAQS++FPQFK +E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
            G LAPTGLHLG TKYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLLEQGM 131
            +VERLGDYL+EQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 27. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 220.6 bits 763,  Expect = 1e-59
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIDGH---RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
            MSWQ YVDDHLMCDI+GH   RLTAAAI+GHDGSVWAQS++FPQFK +E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
            G LAPTGLHLG TKYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLLEQGM 131
            +VERLGDYLLEQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 28. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 220.3 bits 762,  Expect = 1e-59
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ Y D+HLMC+I+G+RL AAAIIGHDGSVWAQSS+FPQ+K +E+  +M DF+EPGSL
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTSQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 29. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 220.0 bits 761,  Expect = 2e-59
 Identities = 107/131 81%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVD+HLMCDIDG+   L AAAIIGHDGSVWAQSS+FPQFK++E++ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
             LAPTGLHLG TKYMVIQGE GAVIRGKKGSGG+T+KKTSQAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 30. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 219.2 bits 758,  Expect = 3e-59
 Identities = 108/131 82%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+I+G+RLT+AAIIG+DGSVWAQS++FPQFK +E+ AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGE GAVIRGKKG GGITVKKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 31. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 219.2 bits 758,  Expect = 3e-59
 Identities = 107/131 81%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIDGH---RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
            MSWQ YVDDHLMCDI+GH   RLTAAAI+GHDGSVWAQS++FPQFK +E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
            G LAPTGLHLG TKYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLLEQGM 131
            + ERLGDYLLEQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 32. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 218.6 bits 756,  Expect = 4e-59
 Identities = 105/130 80%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+I+G+ L+AAAIIG+DGSVWAQS++FPQFKS+E+  IM DF EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 33. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 218.6 bits 756,  Expect = 4e-59
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTY D+HLMC+I+G+RL AAAIIGHDGSVWAQSS+FPQ+K +E+  +M DF+EPGSL
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGAVIR KKG GG+TVKKTSQALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 34. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 218.3 bits 755,  Expect = 5e-59
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH L +AAI+GHDG+VWAQS+ FPQFK +E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTG+ +   KYMVIQGEPGAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 35. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 218.3 bits 755,  Expect = 5e-59
 Identities = 109/131 83%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVDDHLMC+I+G  + L+AAAI+G DGSVWAQS+SFPQFK DE++A++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGLHLG TKYMVIQGEPG VIRGKKG GGI VKKT QALIIGIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 36. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 217.2 bits 751,  Expect = 1e-58
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+I+G+ L+AAAIIGHDGSVWAQS++FPQ+K +EV  I+ DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKK++ AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 37. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 217.2 bits 751,  Expect = 1e-58
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQ YVDDHLMC+I+G  + LT AAI+G DGSVWAQS+ FPQFK DE+AAI++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGLHLG TKYMVIQGEPGAVIRGKKG+GGI VKKT QAL++GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 38. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 216.9 bits 750,  Expect = 1e-58
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVD+HLMCDIDG+   LTAAAIIGHDGS+WAQSSSFPQ+K+ E+  I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
             LAPTGLHL  TKYMVIQGEPGAVIRGKKGSGG+T+KKT QALI GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 39. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 216.6 bits 749,  Expect = 2e-58
 Identities = 104/131 79%, Positives = 123/131 93%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIDGH---RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
            MSWQTYVDDHLMC++DG+   +L+AAAIIGHDGSVWAQSS+FP+FK +E+  IMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
            G LAPTGL+LG TKYMVIQGEP AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  IVERLGDYLLEQGM 131
            IVERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 40. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 216.3 bits 748,  Expect = 2e-58
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH L +AAI+GHDG+VWAQS+ FPQFK +E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTG+ +   KYMVIQGEPG VIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 41. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 216.3 bits 748,  Expect = 2e-58
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH L +AAI+GHDG+VWAQS+ FPQFK +E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTG+ +   KYMVIQGEPG VIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 42. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 216.3 bits 748,  Expect = 2e-58
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIDGH---RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
            MSWQ YVDDHLMCDI+GH   RLTAAAI+GHDGSVWAQS++FPQFK +E+  IM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
            G+LAPTGLHLG TKYMVIQGE GAVIRGKKGSGGIT+KKT+QAL+ GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  IVERLGDYLLEQGM 131
            +V RLGD L++QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 43. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 216.1 bits 747,  Expect = 3e-58
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMC+I+GH L +AAI GHDG+VWAQS+ FPQFK +E+  IMKD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTG+ + + KYMVIQGEPGAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 44. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 216.1 bits 747,  Expect = 3e-58
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVDDHLMCDI+G  + LT AAI+G DGSVWAQS++FPQFK DE+AAI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGLHLG TKYMVIQGE G VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 45. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 215.8 bits 746,  Expect = 3e-58
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+I+G+ L+AAAIIGH+GSVWAQS++FPQ+K +EV  IM DF+EPGSL
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG GG+TVKK++ AL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 46. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 215.5 bits 745,  Expect = 4e-58
 Identities = 102/130 78%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+IDG+ L++AAI+GHD +VWAQS +FPQFK +E++AI+ DF+ PGSL
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT+ ALIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYLLEQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 47. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 215.5 bits 745,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGH--RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVDDHLMCDIDG+   L AA+I+GHDGS+WAQS+SFPQ+K +E+  IMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
             LAPTGL++  TKYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 48. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 215.2 bits 744,  Expect = 5e-58
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDI+G+ L+AAAI+GHDGSVWAQS +FP++K +EVA ++KDFDEPG+L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL +G TKYMVIQGEPG VIRGKKG+GGIT+KKT  +LIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 49. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 214.9 bits 743,  Expect = 6e-58
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHL+CDI+G+ LT AAIIG+DGSVWAQS+ FPQFK +E+ AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 50. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 214.7 bits 742,  Expect = 7e-58
 Identities = 101/130 77%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVD+HLMC+I+G+ L+AAAI+GHDGSVWAQS SFP++K +EVA I+KDFDEPG+L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL +G TKYMVIQGEPG VIRGKKG+GGIT+KKT  +LIIG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 51. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 214.1 bits 740,  Expect = 1e-57
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDDHLMCDIDGH---RLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEP 57
            MSWQ YVDDHLMC+++G+    LTAAAIIGHDGSVWAQSS+FPQ K +E+A IMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNM 117
            G LAPTGL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKT QAL+ G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  IVERLGDYLLEQGM 131
            IVERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 52. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 213.5 bits 738,  Expect = 1e-57
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDGHRLT--AAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVD+HLMCDIDG+     A+AI+GHDGSVWAQSSSFPQFK  E+  IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
             LAPTGLHLG  KYMVIQGE GAVIRGKKGSGGIT+KKT QAL+ GIY+EP+TPGQCNM+
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 53. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 213.0 bits 736,  Expect = 2e-57
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHL+C I+G+ LT AAIIG+DGSVW QS+ FPQFK +E+ AIM DF+EPGSL
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT  ALIIGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 54. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 212.7 bits 735,  Expect = 3e-57
 Identities = 101/130 77%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHL C+IDG+ LT+AAI+GHDG VW QS +FPQFK +E+A I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT   LI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 55. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 212.7 bits 735,  Expect = 3e-57
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            M WQTYVDDHLMC+I+G  + L+ AAI+G DGSVWAQS+SFPQFK DE+AA++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGLHLG TKYMVIQGEPG  IRGKKG GGI VKKT QAL+ GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 56. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 211.9 bits 732,  Expect = 5e-57
 Identities = 100/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSW+ YVDDHL C+IDG+ LT+AAI+GHDGSVWAQS +FPQFK +E+A I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 57. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 211.3 bits 730,  Expect = 7e-57
 Identities = 98/131 74%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMCD++G+RLTAAAI+G+DGSVWAQS++FPQ+K +E+  I  DF EPG+L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL +G TKYMVIQGEP AVIRGKKG+GG+T+KKT+QA++ GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 58. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 211.3 bits 730,  Expect = 7e-57
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVDDHLMC+I+G  + LTAAAI+G DGSVWAQS++FPQFK DE++A++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGLHLG TKYMVIQGE G VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 59. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 210.7 bits 728,  Expect = 1e-56
 Identities = 99/131 75%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHLMC+I+G+ LT+AAIIG+DGSVWA+S +FPQ+K +E+  I+ DF+EPG+L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL++G +KYMVIQGEPGAVIRGKKG GG+TVKKT+ AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 60. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 210.4 bits 727,  Expect = 1e-56
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHL C+IDG+ LT+AAI+GHDGSVW +S +FP+FK +E+A I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 61. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 210.4 bits 727,  Expect = 1e-56
 Identities = 99/130 76%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVDDHL C+IDG+ LT+AAI+GHDGSVWA+S +FP+FK +E+A I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 62. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 209.9 bits 725,  Expect = 2e-56
 Identities = 96/130 73%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HLMCD+DGH LT+AAI+GHDGSVWAQS+ FP++K  E+ AI+ DF+EPGSL
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTG+++   KYMVIQGEPG VIRGKKGSGG+T+KK++ ALI G+YDEP+TPGQCN++VE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 63. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 209.6 bits 724,  Expect = 2e-56
 Identities = 100/130 76%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSW+ YVDDHL C+IDG+ LT+AAI+GHDGSVWAQS +FPQFK +E A I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG TKYMVIQGEPG VIRGKKG+GGIT+KKT  ALI+GIYDEP+TPGQCN++VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLLEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 64. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 209.0 bits 722,  Expect = 3e-56
 Identities = 100/131 76%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ YVD+HLMC+I+G+ LT+AAIIG+DGSVWAQS +FPQ+K +EVA I+ DF +PG+L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL++G TKYMVIQGEPGAVIRGKKG GG+TVKKT  AL+IGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 65. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 207.4 bits 716,  Expect = 1e-55
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HL+C+I+G  L++AAI+G+DG VWAQSS FPQFK +E+ AIM DF EPGSL
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEPGA+I GKKG GG+T++KT+QALIIGIYD+P+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 66. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 206.8 bits 714,  Expect = 2e-55
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HL+C+ +G+ LT+AAIIG+DG+VWAQS++FPQFK +E+  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 67. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 206.8 bits 714,  Expect = 2e-55
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVD+HL+C+ +G+ LT+AAIIG+DG+VWAQS++FPQFK +E+  IM DF  PG+L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT+QALIIGIYDEP+TPGQCNMIVE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLLEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 68. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 205.4 bits 709,  Expect = 4e-55
 Identities = 101/131 77%, Positives = 116/131 88%, Gaps = 1/131 0%
Query  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGS 59
            MSWQ YVDDHLMCD+ DG+   +AAIIGHDGSVWAQS++FPQ+K +EV  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIV 119
            LAPTGL LG TKYMVIQGE GAVIRGKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 69. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 203.4 bits 702,  Expect = 2e-54
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDI-DGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGS 59
            MSWQ YVDDHLMCD+ DG+ L +AAIIGHDGSVWAQS++FPQ+K +EV  IM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIV 119
            LAPTGL LG TKYMVIQGE GAVI GKKGSGG T+KKT QA++IGIYDEP+TPGQCN++V
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLLEQGM 131
            ERLGDYLLEQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 200.1 bits 690,  Expect = 2e-53
 Identities = 97/131 74%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVDDHLMCDI+G  + LT+AAI G DG+VWA+S+SFP+FK +E+ AI+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
             LAPTGL LG  KYMVIQGE GAVIRGKKG+GGI +KKT QA++ GIYDEP+ PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLL+QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 71. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 199.5 bits 688,  Expect = 3e-53
 Identities = 95/131 72%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQ YVD+HLMCDI+G  + LT+AAI+G DG+VWAQS+ FPQFK +E+  I+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTG+ +   KYMV+QGEPGAVIRGKKG+GGI +KKT QA+I+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYLLEQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 72. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 198.1 bits 683,  Expect = 7e-53
 Identities = 94/128 73%, Positives = 112/128 87%, Gaps = 0/128 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQ+YVDDHLMCD++G+ LTAAAI+G+DGSVWAQS+ FPQ+K  E+  I KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
            APTGL LG  KYMVIQGE GAVIRGKKG GG+T+KKT+QAL+ G YDEP+T GQCN++VE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLLE 128
            RLGDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 73. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 197.2 bits 680,  Expect = 1e-52
 Identities = 95/131 72%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDID--GHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQ YVD+HLMC+I+  G+ LT++AI+G DGS+WAQSS+FPQ K  E+ AI K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGL LG  KYMVIQGEPGAVIRGKKG GG+ +KKT+QALI GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 192.7 bits 664,  Expect = 3e-51
 Identities = 93/131 70%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
            MSWQTYVDDHLMCDI+G  + LTAAAI+G DG+VWA+S  FP+FK +E+  I+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
            +LAPTGL LG  KYMV+QGE GAVIRGKKG+GGI +KKT QA+++GIYDEP+ PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLLEQGM 131
            VERLGDYL++Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 179.9 bits 618,  Expect = 2e-47
 Identities = 88/109 80%, Positives = 101/109 92%, Gaps = 0/109 0%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
            MSWQTYVDDHLMC+I+G+ LT+AAIIG+DGS+WAQS+SFPQFK +E+ AIM DF EPG+L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEP 109
            APTGL+LG TKYMVIQGE GAVIRGKKG GG+TVKKT+QALIIGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 144.9 bits 494,  Expect = 8e-37
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 28/130 21%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQ------------------- 41
            MSWQTYVDDHLMCD++GH L +AAI+G DGSVWAQS +FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKSDEVAAIMKDFDEPGSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGI 92
                     FK +E+  IMKDFDEPG LAPTGL LG TKYMVIQGEPGAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTSQALIIGIYDEPLTPGQCNMIVERLGDYLLEQG 130
            T+KKT QALI GIY+EP+TPGQCNM+VE++GDYL++QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 83.5 bits 275,  Expect = 2e-18
 Identities = 50/122 40%, Positives = 76/122 62%, Gaps = 8/122 6%
Query  1    MSWQTYVDDHLMCDIDGHRLTAAAIIG-HDGSVWAQ-SSSFP-QFKSDEVAAIMKDF-DE 56
            MSWQ+YVD+++   +D  RL  A I G +DG+VWA+    +P Q    E+  I       
Sbjct  1    MSWQSYVDNQICQHVDC-RL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCN 116
            P S+   G+HLG  KY+ IQ +  +++RG+KGS  + +  T+  L+     + + PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MIVERLGDYL 126
             +VE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.